KEGG   Nocardia terpenica: CRH09_06330Help
Entry
CRH09_06330       CDS       T05168                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ntp  Nocardia terpenica
Pathway
ntp00020  Citrate cycle (TCA cycle)
ntp00190  Oxidative phosphorylation
ntp00650  Butanoate metabolism
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
ntp01120  Microbial metabolism in diverse environments
ntp01130  Biosynthesis of antibiotics
ntp01200  Carbon metabolism
Module
ntp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ntp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ntp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRH09_06330
   00650 Butanoate metabolism
    CRH09_06330
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CRH09_06330
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CRH09_06330
    1.3.5.4  fumarate reductase (quinol)
     CRH09_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 HI0933_like Pyr_redox_2 DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ATL65887
UniProt: A0A291REV3
LinkDB All DBs
Position
complement(1377843..1379627)
Genome map
AA seq 594 aa AA seqDB search
MSESRPVQEHRYDVVIVGAGGAGMRAAIEAGPRVRTAVLTKLYPTRSHTGAAQGGMCAAL
ANVEEDNWEWHTFDTVKGGDYIVDQDAAEIMAKEAIDAVLDLEKMGLPFNRTPEGKIDQR
RFGGHTRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFYNEFYVLDLVLTNTDRG
PVATGVVAYELATGDIHAFHAKSIVFATGGSGRMYKTTSNAHTLTGDGMAIVFRKGLPLE
DMEFHQFHPTGLAGLGILISEAVRGEGGILRNADGERFMERYAPTIKDLAPRDIVARSMV
KEVLEGRGAGPNKDYVYIDVTHLGEDVLEEKLPDITEFSRTYLGVDPVKEPVPVMPTCHY
VMGGIPTRIRGEVLRNNTDVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAA
AEYAQRSEFAEMPENPAAMVQGWLAGLLSEHGNERVADIRTELQATMDANAAVFRTEETL
KQALTDIHALKERYEHITVQDKGKRYNSDLLEAVELGFLLELAEVTVVGALNRKESRGGH
AREDYPDRDDTNFMRHTMAYKDVEPGAQANLLADIRLDFKPVVQTRYEPMERKY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatctcgtcctgtccaggagcaccgctacgacgtcgtcatcgtcggcgcgggt
ggcgcggggatgcgcgcggcgatcgaggccgggccccgggtccgcaccgccgtgctgacc
aagctgtacccgacccgcagccacaccggcgccgcccagggcggcatgtgcgccgcgctg
gccaatgtcgaagaagacaactgggagtggcacaccttcgacaccgtcaagggcggcgac
tacatcgtcgaccaggacgccgcggagatcatggccaaggaggccatcgacgcggtgctc
gacctggagaagatgggtctgccgttcaaccggaccccggaaggcaagatcgaccagcgc
cgcttcggcggtcacacccgtgaccacggcaaggccccggtccgccgcgcctgctacgcc
gccgaccgcaccggccacatgatcctgcagacgctgtaccagaactgcgtcaagcacgac
gtggagttctacaacgagttctacgtgctggacctggtgctgaccaacaccgaccgcggc
ccggtcgccaccggcgtggtcgcctacgagctggccaccggcgacatccacgccttccac
gccaagtcgatcgtgttcgccaccggcggctccggccgcatgtacaagaccacctccaac
gcgcacacgctgaccggcgacggcatggcgatcgtgttccgcaagggacttccgctggag
gacatggagttccaccagttccatccgacgggcctggcgggtctgggcatcctgatctcc
gaggccgtccgcggcgagggcggcatcctgcgcaacgccgacggcgagcggttcatggag
cgctacgcccccaccatcaaggacctcgcgccgcgcgacatcgtcgcccgctcgatggtc
aaggaggtcctggagggccgcggcgcgggaccgaacaaggactacgtctacatcgacgtg
acccacctcggcgaggacgtgctcgaggagaagctgcccgacatcaccgagttctcccgc
acctacctgggtgtggacccggtgaaggagccggtgccggtcatgccgacctgccactac
gtgatgggcggcatcccgacccgcatccgcggcgaggtgctgcgcaacaacaccgacgtg
gtgcccggcctgtacgccgcgggcgagtgcgcgtgcgtatcggtgcacggcgcgaaccgc
ctgggcaccaactcgctgctggacatcaacgtgttcggccgccgcgcgggcatcgccgcc
gcggagtacgcccagcgctccgagttcgccgagatgccggagaacccggccgccatggtg
cagggctggctggcgggcctgctgtcggagcacggcaacgagcgcgtcgccgacatccgc
accgaactgcaggcgaccatggacgccaacgccgcggtgttccgcaccgaggagaccctc
aagcaggcgctgaccgacatccacgcgctcaaggagcgctacgagcacatcaccgtgcag
gacaagggaaagcgctacaacagcgatctgctcgaggccgtcgagctgggcttcctgctg
gagctggccgaggtcacggtggtcggcgcgctcaaccgcaaggagtcgcgcggcgggcac
gcccgcgaggactacccggaccgcgacgacaccaacttcatgcgccacaccatggcgtac
aaggacgtcgagccgggggcgcaggcgaatctgctcgccgacatccggctggacttcaag
ccggtcgtgcagacccgttacgagccgatggagcgtaagtactga

DBGET integrated database retrieval system