KEGG   Nocardia terpenica: CRH09_08685Help
Entry
CRH09_08685       CDS       T05168                                 

Definition
(GenBank) cyclase
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
ntp  Nocardia terpenica
Pathway
ntp01056  Biosynthesis of type II polyketide backbone
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
Module
ntp_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    CRH09_08685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ntp01004]
    CRH09_08685
   01008 Polyketide biosynthesis proteins [BR:ntp01008]
    CRH09_08685
Enzymes [BR:ntp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     CRH09_08685
Lipid biosynthesis proteins [BR:ntp01004]
 Polyketide synthase
  Component type
   CRH09_08685
Polyketide biosynthesis proteins [BR:ntp01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     CRH09_08685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc Polyketide_cyc2 AHSA1
Motif
Other DBs
NCBI-ProteinID: ATL66264
UniProt: A0A291RGL2
LinkDB All DBs
Position
1956545..1957468
Genome map
AA seq 307 aa AA seqDB search
MAEHTYSHAAWCAGSPGDAYGLVADVTLWPIVFGPTVAVDVLDRSDRGPVVTEEFRITAL
VDDRVRGWTSRRELNADEWTIGFRQEHARPPIESMSGTWTFRPDRGGTRVELVHRCVLAD
DGADTRAWLEAALDANSERELGALTDLCAAAVPVGDLVLRCADTVPVDDIDHAYRAIDDA
GSWPDRLPHVLESVLTEPEPGTQDLRMTVRTPDGTVHRTRSIRLCTAGKRIRYKQLQTPD
GLAGHSGRWDFDRDTATVTGSHLALLDPRTVTDREQAARLRETFGARLRANSRATLTTLT
GVAGHRS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcacacctactcgcacgcggcctggtgcgcgggatcgccgggggacgcctac
gggctggtcgccgatgtcaccctgtggccgatcgtcttcggcccgaccgtcgcggtcgac
gtgctggaccggagcgaccgcggcccggtggtcaccgaggagttccggatcaccgcgctg
gtcgacgatcgggtgcgcggctggacctcgcgccgggaattgaatgccgacgagtggacg
atcggcttccgccaggagcatgcccgcccgccgatcgaatccatgtccggcacctggact
ttccgccccgaccgcggcggcacccgggtggagctggtgcaccgctgcgtgctggccgac
gacggagccgacacccgcgcctggctggaggcggcgctcgacgccaattccgaacgggaa
ctgggcgcgctcaccgatctgtgcgccgcggcggtccccgtcggcgatctggtcctgcgc
tgcgccgacaccgtgccggtcgacgacatcgaccatgcctaccgggccatcgatgacgcc
ggatcgtggccggaccggctgccgcacgtgctcgaatccgtgctgaccgaaccggaaccg
ggcacccaggatctgcggatgaccgtgcgcacccccgacgggaccgtgcaccggacccga
tccatccggctgtgcaccgccggaaaacggatccgctacaagcaattacagacaccggac
gggctggccgggcacagcggccgctgggacttcgaccgggacaccgcgaccgtcaccggc
agccatctggcgctgctggatccgcgcaccgtgaccgaccgcgagcaggcggcccggttg
cgcgaaaccttcggcgcccgactgcgcgccaacagccgggcgaccctcaccacgctcacc
ggcgtcgcgggacaccggtcatga

DBGET integrated database retrieval system