KEGG   Nocardia terpenica: CRH09_15145Help
Entry
CRH09_15145       CDS       T05168                                 

Gene name
katE
Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
ntp  Nocardia terpenica
Pathway
ntp00380  Tryptophan metabolism
ntp00630  Glyoxylate and dicarboxylate metabolism
ntp01110  Biosynthesis of secondary metabolites
ntp01130  Biosynthesis of antibiotics
ntp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CRH09_15145 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CRH09_15145 (katE)
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CRH09_15145 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ATL67336
UniProt: A0A291RID3
LinkDB All DBs
Position
3393936..3396053
Genome map
AA seq 705 aa AA seqDB search
MDGAAAASNDKQRQLDSYRVDRRAGRLTTQQGVRVPSTDDALKVGERGPTLLEDFHAREK
ITHFDHERIPERVVHARGAGAYGRFRPYDSWLDRYTTARFLTDPSVETPVFVRFSTVAGS
RGSADTVRDVRGFATKFYTAEGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQA
ASAHDTLWDFVGEQPETLHAIMWLMSDRALPRSFRMMQGFGVHTFRFLDRSGAATFVKFH
WKPKLGVHSLLWDECQQIAGHDPDFNRRDLWDCIEAGRFPEWELGVQLIPEEQEFAFDFD
LLDATKLVPEEQVSVRAVGTMVLDRNPDNFFAETEQVAFHTANLVPGIDFTDDPLLQLRN
FSYLDTQLIRLGGPNFAQLPINRPVADVRNHQQDGYSQHAIPRGEAAYTKNTIGGGCPMI
ADEGTMRHVAEPLYGTPVRERADTFREYYSQPRMFWRSMSEPEADHIVAAFAFELGKVER
PAIRARVLERLASIDPDLVARVANELGMPTPATDPDTSNAVISPALSQLTEAAETIETRK
IAILTADGADTTGVRSIQTWLADRGAVPEIVAPHGGSVTALTDADEPLPVRRSLPTVSSV
LYDGVIVAGGPDAADTLIRTGPAMFFVLEAFKHAKPVGGVGAGLTVLRTAGITFHLPTDT
DLVSEHGVVVTSTSGEGVPERFVELFAKSLSQHRIWRRRTAIVPA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggatggcgcagccgccgcatcgaatgacaaacagcgacaactggattcgtatcgggtc
gaccgccgggccgggcgcctgaccacgcagcagggcgtgcgggtgcccagcaccgacgac
gcgctgaaggtgggggagcgcggacccaccctgctcgaggacttccacgcgcgggagaag
atcacccacttcgaccacgagcggattcccgaacgcgtggtgcacgcacgcggcgccggc
gcctacgggcgcttccggccgtacgacagctggctcgatcggtacaccaccgcaaggttt
ctcaccgatccgagcgtggaaacgcctgtgttcgtgcgcttctccaccgttgccgggtcg
cgcggctcggcggacacggtgcgcgacgtgcgcgggttcgccaccaagttctataccgcc
gaaggcaattacgatctggtcggcaacaacttcccggtgttcttcatccaggacggcatc
aagtttcccgacttcgtgcacgcggtgaaacccgagccgcacaacgagattccgcaggcc
gcctccgcgcacgacaccctgtgggacttcgtgggcgagcagccggagacgctgcacgcc
attatgtggctgatgtcggatcgcgcgctgccgcgcagcttccggatgatgcagggcttc
ggggtgcacaccttccgcttcctcgaccgttccggtgcggccaccttcgtgaagttccac
tggaagccgaaactcggtgtgcattccctgctctgggacgaatgccagcagatcgcgggg
cacgatccggacttcaatcggcgcgacctgtgggactgcatcgaggcgggccggttcccg
gagtgggaactcggcgtgcagctgattcccgaggagcaggagttcgccttcgacttcgac
ctgctggacgcgacgaaactcgttcccgaggaacaggtctcggtgcgcgcggtcggaacc
atggtgctcgaccgcaatccggacaacttcttcgccgagaccgagcaggtcgccttccac
accgcgaacctggtgcccggcatcgacttcaccgacgatccgctgctgcaactgcgcaat
ttctcctacctcgacacccagctgatccggctgggcggaccgaacttcgcgcagctgccg
atcaatcggcccgtcgccgacgtgcgcaaccatcagcaggacgggtacagccagcacgcc
attccgcgcggtgaggccgcctacaccaagaacaccatcggtgggggctgcccgatgatc
gcggacgagggaaccatgcggcacgtcgcggaaccgttgtacggcacgccggttcgcgag
cgcgccgacaccttccgggagtactacagccagccgcgcatgttctggcgcagcatgtcc
gagcccgaggcggaccatatcgtcgccgccttcgccttcgaactgggaaaggtggaacgc
ccggccattcgcgccagggtgctcgaacggctcgcgagcatcgatcccgatctcgtggcg
cgggtggcgaacgagctcggaatgcccacccccgcaaccgatcccgacacatcgaacgcg
gtgatctcacccgcgctgtcgcaactgaccgaggcggccgagaccatcgagacccgcaag
atcgcgatcctgaccgccgacggcgccgacaccaccggagtgcgcagcatccaaacctgg
ctcgccgaccgcggcgccgtaccggaaatcgttgcaccgcacggcggatcggtgaccgca
ctcaccgacgccgatgagccgctgccggtgcggcgctcgctgccgaccgtctcgtcggtg
ctctacgacggagtgatcgtggccgggggccccgacgccgccgacaccctcatccgcacc
ggcccggccatgttcttcgtgctcgaggcattcaagcacgccaagccggtcggcggagtc
ggtgctgggctgaccgtcctgcgcaccgcgggtatcaccttccacttgcctacggacacc
gatctggtcagcgagcacggggtggtggtcacctcgacctcgggtgaaggggtaccggag
aggtttgtcgagctgttcgcgaaatccctgtcgcagcaccggatctggcgtcgccgcaca
gcgatcgttcctgcttga

DBGET integrated database retrieval system