KEGG   Nocardia terpenica: CRH09_20610Help
Entry
CRH09_20610       CDS       T05168                                 

Definition
(GenBank) polyketide synthase
Organism
ntp  Nocardia terpenica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N adh_short_C2 Epimerase Docking SAT Polysacc_synt_2 GDP_Man_Dehyd RmlD_sub_bind ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ATL71963
UniProt: A0A291RWR8
LinkDB All DBs
Position
complement(4626150..4636157)
Genome map
AA seq 3335 aa AA seqDB search
MGPLVNSRSTVTEQKLRDYLNRVTIDLQRTRRQLAEAEAAGHEPIAIVSMSCRFPGGVRT
PEQLWDLVSAGRDAVTEVPADRGWDVEGLGGSPRGAFIDGIADFDAGFFAVSPHEATAMD
PQQRLLLTTVWEAVERAGIDPAALRGTATGVFAAAVDQGYAQVGMAAPAAVRNFIVTGNS
MSVLSGRVSYALGLEGPALTVDTACSSSLVAVHLAAQALRRRECTLALAAGVTVMSLPLV
YAEFGRQGAMSADGRCKAFSATADGTGWGEGVGVVLLERLSDALRNGHRIHAVIRGSALN
QDGASNGLTAPNGPSQQRLIQAALADAGLAAADVDAVEAHGTGTTLGDPIEADALLATYG
RDRPADRPLWLGSLKSNIGHTQAAAGVAGVIKAVLALEHGMLPRSLHLTEPTPHVDWSSG
AVRPLTGNRPWPRVERPRRVGVSAFGMSGTNAHMILEQAPAAEPAAAGPRPPRPAAAPYV
LAGRTPAALRDQAVRLAAVLSADPAPELADIGFSLVTTRTAFEQRAVLVAGDRAELLGGL
GALVCEDTVVPGVVVGESDSGVGRTVLVFPGQGSQWDGMARDLLAEAPVFAASVADCERA
LAGLVDWSLTEVLCGAPGAPSLDRVDVVQPALFAMMVSLAALWRSWGVEPDAVVGHSQGE
IAAAVVAGGLSLADGVKVVALRSRALGALAGRGGMVALALGHERAQQEIAPWDGRVSVAA
VNGPAAVVVSGDPDALAELVARCAERGVRATTVPVDYASHSAHVERIRDELRTALADIAP
RTSDIPLLSTLTGDWLDTAGMDADYWYRNLRGTVRFDTAIRDLARQGHDVFVEVSPHPVL
TVPVQDTVEDAGLTAAVVTGTLRRDEGTLRRALAAAAELWVRGVPVDWTASFPGARPIEL
PTYPFQERRYWPEPAERPDPGAALADNELRHQDPTDSLRYRIAWRRLADPAAAMLTGRWL
LVLPAAESESPQAQWTVRALTELGAEVTVVELADDDIDRARLAARLTADGDIAPTGIVSL
LAVAERPHPEHPALPVGAALTVALLQAITDTGWTAPLWCVTTGAVATAATEPLTAPHQAL
VWGTGMVAALEFPLRWGGLVDLPLEPDDRAALRLGAVLGGTGEAAGEDQVAVRPGGLYAR
RLVRAPRPATADHGPWRPRGTVLLTGGTGALGPHLVRWLARGGAEHLVLPGRRGADTPVA
DQLRADLAAHGTRLSMPVCDLSDRDQVERMLADLDEQGSPVTAVVHAAALIALAPLETTP
LSAFAGVVAAKAAGAAHLDALLDRDLDAFVLFSSIAGVWGSGDHGAYAAGNAYLHALAQH
RRARGLTATTVDWGVWRSVVPGTPPATDLFKLDEHGLRRMDPEAAVAALQQVLDDDETVV
AIADVDWERFAPVFTSGRPSPLLRTIPEARAALAGDTTDSANPVAAQLRQRLARLSAAER
SRALLDVVRAQAAAVLGHDSPQQVPPGKAFQELGFASLTAVELRNRLNTATGLRLPSSLV
FDHPSAGALAAHLESELFAQPESDSAAPSFAAADDDPIAIVALGCRLPGGIDTPEKLWQL
LREGGDTVTGFPADRGWPGEEIYHPDPDNPGTATTRSGGFLHDAAEFDAGFFGISPREAV
AMDPQQRLLLETCWEALERAGLDPEALRGSRTGVYIGVNYGDYGSAVARSGQGEGHLLTG
SAPSIVSGRIAYTFGLEGPAVTIDTACSSSLVALHTAVRALRGGDCSLALVGGVAVMSTP
GAILSFSRQRGLAADGRCKAFAEAADGMGMGEGVGVLVVERLGDARRNGHPVLAVLRGSA
VNSDGASNGLSAPNGPSQQRVIRAALADAGLSGADIDVVEAHGTGTTLGDPIEAQALLAT
YGRDRPAERPLLIGSLKSNIGHTQAASGVAGVLKMVLALRNSQVPPTLHIDRPTSHVDWD
TGAVTLATDLVPWPETGRARRAGISSFGLSGTNAHVILEQASEPEAPAAPANSVSGPLAW
VLSARAPAALADQASRLREQLDRTGGASPADVGLTLAGRTAFAHRRVLVGTGDELVIALR
ALADGTETPAVVSGVQDAEGRTVFVFPGQGSQWAGMARELLDESPVFAEKMTECEAALSA
HVDWSLLEVVRSAAPLTRVDVVQPALFAVMVSLAAVWRSHGVEPDAVVGHSQGEIAAAVV
AGGLSLADGARVVALRSRALGELAGTGAMVSIALPVPRVEQLLAPWGQRLSVAAVNGPAA
VVVSGEAAAITELLAGCDAEGIRARRIDVDYASHSAQVEPIEAALLAALDPITPAAAEVP
LFSTVTGEWLDTGVMDAAYWYANLRRTVGFEPAVRALSEQGFTTFLEVSPHPVLTVPIEE
TLEAAERDGIVLATLRRDEGDLRRLLLSLGEAWVHGRPVHWPGLFAGARRIDLPTYPFQH
RHYWATPGPGTGGEDVAAAGLDAARHPLLGAAAEVADTGEILLSGRLSVRSQPWLADHAV
SDVVLLPGAAFVELALRAATEAGCTVLDELTLEAPLVLPDTGAVRIQARVGAIDETGCRT
LTIHSRTEDGLDSRWTRHATGTVTERAATPPAEPESWPPPGATPVPVDDLYDRFDASGYR
YGPAFRGVRAAWRRGNEIFTEVALPDRDDRAASAYGVHPALLDAALHGMRLGPADGAAAA
AAEPGTAQVPFSWNTVTLHAVGATRLRIRLAFTADGEVRIDATDPQGHPVASVAALAVRP
IRTDTLLSAAAPDALFRVEWTPLPGLAAELPPAGRWAAIGSAGLLPDTHPDLTALGTAID
QGAPVPDVVLADCRSAGTDAASVHTATAAALALIQQWLADDRYADSRMVFVTSGAVEAHP
GEGVADPAGAAVCGLVRSAQSEHPDRFVLADAADPAELIALLPAATAAREPHFALRTGEL
LAPRLARVPAPTAAAPTFDPSGTVLITGASGVLAGLLARHLVREHGVRHLLLLSRRGPDA
PEAAGLRTDLTELGAEATFAACDVADRDALAAVLAAVPAAHPLTAVVHTAGVLDDGTVAA
LTPARLDTVLRPKVDGALHLHELTRDLPLTAFLLFSSAAGVIGNAGQANYAAANAFLDAL
AARRRAQGLPAHAIAWGLWESRSEMTGALDDTGRRRMTRGGVAALSDAAGLALFDAVLHQ
DSALLVPVRLDLGRQRPTTADVPALLRGLVRGVTRPRAATADAAAADTLRRRLAEAGAPE
RKSLLEDLVRDRVARVLRHPGGEAVDPESAFSELGFDSLTSVELRNQLNAVTGLRLPATL
VFDHPTPEAVAAYLAERLAPAPPDAPAADTDDAAVRRLLATIPPQRLRSAGLLDALLRLR
DPGPAPEPPAPEETESIREMDVDGLVRMALGDNRA
NT seq 10008 nt NT seq  +upstreamnt  +downstreamnt
attgggcctctcgtgaacagtaggagcaccgtgaccgagcagaagctccgcgactatctc
aaccgcgtcaccatcgacctgcagcgcacccgcaggcaactcgccgaggccgaggccgcc
gggcacgagccgatcgcgatcgtctcgatgagctgccgcttccccggcggcgtccgcacc
cccgagcagctgtgggatctggtgtccgcgggccgggacgcggtgaccgaggtgcccgcc
gaccgcggctgggacgtcgaggggctcggcggatccccccggggcgccttcatcgacggg
atcgccgacttcgacgccggattcttcgcggtctccccgcacgaggcgaccgccatggac
ccgcagcagcgcctgctgctgaccaccgtctgggaggccgtcgagcgggccggtatcgat
ccggccgcgttgcgcggcaccgcgaccggcgtgttcgccgcggccgtggatcagggatac
gcccaggtgggcatggcggccccggcggccgtgcggaacttcatcgtcaccggcaattcg
atgagcgtgctgtcgggccgggtgtcctacgcgctcgggctcgagggtcccgcgctcacc
gtcgacaccgcgtgctcgtcctcgctggtcgcggtgcacctggccgcgcaggcgctgcgg
cggcgcgagtgcaccctggccctggccgcaggcgtcacggtgatgtcgctgccgctggtc
tacgctgaattcggcaggcagggcgcgatgtcggccgacggccgctgcaaggcgttctcg
gccaccgccgacggcaccggctggggcgagggcgtcggcgtcgtgctgctggagcggctg
tccgacgcgctgcgcaacggacaccgcatccacgccgtcatccgcggttccgccctgaac
caggacggcgccagcaacggcctgaccgcccccaacgggccctcgcagcagcggctcatc
caggcggcgctggccgatgccggactcgccgccgcggatgtcgacgcggtcgaggcgcac
ggcaccggcaccacgctcggcgaccccatcgaggcggacgcgctgctggccacctacggc
cgggaccggcccgcggaccggccgctgtggctgggctccctgaaatcgaatatcgggcac
acccaggcggcggccggggtggcgggcgtgatcaaggccgtgctcgcgctcgagcacggc
atgctgccgcgctcgctgcacctcaccgagcccaccccgcacgtcgactggtccagcggc
gcggtccgcccgctcaccgggaaccgcccgtggccgcgcgtggaaaggccacggcgcgtg
ggtgtttcggcgttcggcatgagcggcaccaacgcgcacatgatcctcgagcaggcgccc
gccgccgaacccgcggccgccgggccgcggccgccgcgccccgcggccgccccgtacgtc
ctggccgggcgcactcccgccgcgctgcgcgatcaggcggtgcggctggccgcagtactg
tccgccgatccggcccccgagctcgccgatatcgggttctcgctggtcaccactcggacg
gcattcgagcagcgcgccgtgctggtcgccggggatcgcgccgaattgctcggcggactc
ggcgcgctggtttgcgaggacacggtcgtgcccggtgtcgttgtcggagaaagcgattcg
ggggtcggccggaccgtgctcgtcttccccggccagggctcccagtgggacggcatggcc
cgggacctgctcgccgaggcgccggtcttcgccgcatcggtcgccgactgcgagcgggcc
ctggccgggctggtggactggtcgctgaccgaggtgctgtgcggggcgcccggcgcgccg
tcgctggatcgggtcgatgtcgtgcagcccgcgctgttcgcgatgatggtctccctggct
gcgctctggcgatcctggggagtcgagcccgacgcggtcgtcggccacagccaaggggag
atcgccgccgccgtcgtcgcgggcggcctgtccctggccgatggcgtgaaagtcgttgcg
ctgcgtagccgcgcgctcggtgcgctggccggacgcggtggcatggtcgccctcgcgctc
ggacacgagcgcgcgcagcaggagatcgcgccgtgggatggccgtgtgtcggtggccgcc
gtcaatggccctgccgccgttgtcgtttccggtgatccggacgccctcgccgaactggtc
gcccgctgcgccgaacgcggtgtgcgcgccacgacggtgcccgtcgactacgcctcgcat
tcggcgcacgtcgaacggatccgggacgaattacgcacggccctggccgatatcgccccg
cgaacgagcgacatcccgctgttgtccaccctcaccggcgactggctggacaccgccgga
atggacgccgactactggtatcgcaacctgcgcggcaccgtccggttcgacacggcgatc
cgcgacctcgcccggcaggggcacgatgtcttcgtcgaggtctcaccgcatccggtgctc
accgtgccggtgcaggacaccgtcgaggacgcgggcctgaccgccgcggtggtgaccggc
accctccggcgcgacgaaggaaccctgcgccgggccttggccgccgcggccgaactctgg
gtgcgcggcgtgcccgtcgactggaccgcgtccttccccggcgcgcggccgatcgagctg
cccacctacccgttccaggaacggcggtactggccggaacccgccgagcggcccgacccg
ggcgcggcgctcgccgacaacgaattgcggcaccaggaccccaccgactcgctgcgctat
cgcatcgcctggcggcggctcgccgatccggccgccgcaatgctcaccggccgatggctg
ctcgtgctgcccgccgcggaaagcgagtcgccgcaggcacagtggaccgtgcgcgcgctg
accgaactcggcgcggaggtcaccgtcgtcgaactcgccgacgacgacatcgaccgtgcc
cggctcgccgcccgcctcaccgccgacggcgatatcgcaccgaccggcatcgtctccctg
ctggccgtcgccgagcggccgcatccggagcacccggcgctgccggtgggcgctgcgctc
actgtcgccctgctgcaagcgattacggacaccgggtggaccgcgccgctgtggtgcgtg
accacaggcgcggtcgcgaccgccgccaccgaaccgctcaccgctccccaccaggcgctg
gtctggggtacgggcatggtggccgcgctcgaattccccttgcgctggggcggtttggtg
gatctgcccctggaacccgacgaccgcgccgcgctgcggctcggagccgttctcggcggg
acaggcgaggctgcgggcgaggaccaagtcgcggtgcggcccggcggcctgtacgcccgg
cggctcgtgcgcgcgccgcgcccggcgaccgccgaccacggcccgtggcgtccccgcggc
accgtcctgctgaccggcggcaccggggcactcggcccgcacctggtccgctggctggcc
cgcggcggggccgagcacctggtgctgcccggccgccgcggcgcggacacccccgtcgcc
gaccagttgcgcgccgacctggccgcccacggcacccggttgagcatgccggtctgcgac
ctcagcgaccgcgaccaggtcgagcgaatgctcgccgatctcgacgagcagggcagcccg
gttaccgcggtggtgcacgccgccgccctgatcgccctcgcaccgctcgagaccacaccc
ctgtcggcgttcgcgggtgtggtggcggccaaggccgccggggccgcgcacctcgacgcc
ctgctcgaccgggacctcgacgccttcgtcctgttctcctcgatcgcgggcgtctggggc
agcggcgaccacggcgcctacgccgcgggcaatgcctacctgcacgcactcgcccagcac
cgccgcgcccgcggactgaccgcgaccaccgtcgactggggcgtctggcgcagcgtcgtc
cccggcacacccccggccaccgacctgttcaaactggacgagcacggcctgcgccggatg
gaccccgaggccgccgtcgccgccctccagcaggtgctcgacgacgacgagaccgtcgtc
gcgatcgccgacgtggactgggaacgattcgctcccgtcttcacctccggccgccccagc
ccgctgctgcgcaccattcccgaggcccgcgccgcgctcgcgggcgacaccaccgattcc
gcgaatcccgttgcggcgcaactacgtcagcgactggcccggctgtcggccgcggagcgg
tcgcgcgcgctgctcgacgtggtccgcgcccaggccgccgcggtcctcggccacgactcg
ccgcagcaggtgccgccgggcaaggcattccaggaactgggtttcgcctcgctgaccgcg
gtcgaactgcgcaaccggctcaacaccgccaccggcctgcggctcccgtcctcgctggtc
ttcgaccatccgtccgccggtgcgctggccgcgcacctcgagtccgaactgttcgcgcag
ccggaatccgattccgccgcaccgtcgttcgccgccgcggacgacgacccgatcgcgatc
gtcgccctgggctgccgcctgcccggcgggatcgacaccccggagaagctgtggcagctg
ctgcgcgagggcggcgacacggtcaccggcttccccgcggaccgggggtggccgggggag
gagatctaccatccggacccggacaaccccggcaccgccaccacgcggtccggcggattc
ctgcacgacgccgccgaattcgatgcgggcttcttcggaatctccccgcgcgaggcggtc
gccatggatccgcagcagcggctgctgctggagacctgctgggaggccctggagcgggcg
ggcctggacccggaggcgctgcgcggctcccggaccggcgtctacatcggcgtcaactac
ggcgactacggctcggccgtggccagatccgggcagggggagggccatctgctcaccggg
agcgccccgagcatcgtctccggccgcatcgcctacaccttcggcctcgagggtcccgcc
gtcaccatcgacaccgcctgctcgtcgtcgctggtggcgctgcacaccgcggtccgggcg
ctgcgcggcggcgactgctcgctcgccctggtcggcggcgtcgccgtgatgtcgacgccc
ggcgcgatcctgagcttctcccggcagcgcggtctcgccgccgacggccggtgcaaggcg
ttcgccgaggcggccgacggcatgggcatgggcgagggcgtcggcgtgctggtcgtcgag
cggctcggcgacgcccgccgcaacgggcacccggtgctggccgtgctgcgcggttccgcg
gtgaactccgacggcgcgagcaacggcctgtcggcgcccaacggcccgtcccagcagcgg
gtcatccgcgcggcactggccgatgccggactgtcgggcgcggacatcgatgtggtggag
gcgcacggcaccggcaccaccctcggcgacccgatcgaggcgcaggcgctgctggccacc
tacggacgggaccgcccggcggagcggccgctgctgatcggctcgctcaagtccaacatc
ggccacacccaggccgcctccggcgtcgccggggtgctgaaaatggtgctggcgctgcgg
aactcgcaggtgccaccgaccctgcacatcgaccggccgaccagccacgtggactgggac
accggtgcggtgaccctcgcgaccgacctcgtcccgtggccggagaccggccgggcgcgc
cgggcgggcatctcgtccttcggcctcagcggaaccaatgcgcacgtgattctcgagcag
gcgtcggaaccggaagcgcctgccgcgccagcgaattcggtatccggtccgctggcctgg
gtgctgtccgcgcgcgcgcctgcggcgctggcggaccaggcgtcgcggctgcgcgagcag
ctggaccggaccggcggggcgagtccggcggacgtcgggctcaccctcgccgggcgcacc
gcgttcgcgcaccgccgcgtgctggtcggcacgggcgacgaactcgtcatcgcgctgcgc
gccctcgccgacggcacggagacacccgcggtcgtgtccggtgtgcaggatgccgagggc
cggacggtcttcgtcttccccggacaggggtcgcaatgggcgggcatggcacgcgaattg
ctggacgagtcaccggttttcgcggagaagatgaccgaatgcgaggcggccctgtccgcc
cacgtggactggtcgctgctcgaggtggtgcgctcggccgccccgctgacccgggtggac
gtggtgcagccagcattgttcgcggtcatggtgtcgctcgccgccgtctggcgctcgcac
ggcgtcgaacccgatgcggtcgtaggccactcccagggcgagatcgccgccgccgtcgtc
gcgggcggcctctcgctcgcggacggcgcgcgggtggtggccctgcgttcgcgcgccctc
ggcgaactcgcgggcacgggcgcgatggtatcgatcgcgctgccggtgccgcgggtggag
cagctgctcgcgccgtgggggcagcgtttgtcggtggccgcggtgaacgggcctgcggcc
gtggtggtttcgggcgaggccgccgcgatcaccgaactgctggccgggtgcgacgctgag
gggatccgggcccggcgcatcgatgtcgactacgcctcgcactcggcgcaggtcgagccg
atcgaggccgccctgctcgcggcgctggacccgatcaccccggccgccgccgaggtgccg
ctgttctccacggtgacgggggagtggctcgacaccggcgtcatggacgccgcctactgg
tacgccaatctgcgccgcaccgtcggcttcgaaccggccgtgcgcgccctgtcggagcag
ggtttcaccaccttcctggaggtcagcccgcacccggtgctcacggttccgatcgaggag
acgctggaggccgcagagcgagacggcatcgtgctcgccaccctgcgccgcgacgagggc
gacctgcgccgcctgctgctctcgctcggcgaggcctgggtccacggtcgaccagtgcac
tggcccggattgttcgcgggcgcccggcgcatcgacctgccgacctaccccttccagcac
cggcactactgggcgacacccgggcccggaaccggcggcgaggatgtcgccgcggcgggc
ctggacgccgcccggcacccgctgctcggcgcggccgccgaggtcgccgacaccggggag
atcctgctcagcggccggttgtcggtgcgctcccagccgtggctggccgaccatgcggtg
tcggacgtggtcctgctgcccggcgcggcattcgtcgaactggcgctgcgggccgccacc
gaggcgggctgcaccgtcctcgacgaactcacgctcgaggcaccgctcgtactgcccgac
accggggcggtccgcatccaggcgcgggtcggcgcgatcgacgaaaccggttgccgcaca
ctgacaatccactcccgaaccgaggacggtctcgactcgcggtggacgcgccacgcgacc
gggaccgtgaccgaacgcgccgccacacccccggccgagccggagagctggccgccgccg
ggcgccacgccggtgcccgtcgacgacctctacgaccgattcgacgcctccggctaccgg
tacggtccggccttccgcggcgtccgcgcggcctggcggcgcggtaacgagatcttcacc
gaggtcgcgctgcccgaccgcgacgaccgggccgcctcggcctacggcgtgcaccccgcc
ctgctcgacgccgcgctgcacggcatgcggctcggacccgcggacggtgccgcggcggcc
gcggccgaaccgggcaccgcgcaggtgccgttctcctggaacaccgtcaccctgcacgcg
gtcggcgcgacgcggctgcgcatccggctggccttcaccgcggacggcgaggtgcgaatc
gacgccaccgacccgcagggacacccggtggcctcggtcgcggccctggccgtgcggccc
atccggaccgacaccctgctctccgccgccgcaccggacgccctgttccgggtggagtgg
acgccgctacccggcctcgccgcggaactgccccccgccggacgttgggcggcaatcgga
tcggcgggtctgctgccggacacccaccccgatctcaccgcgctcggcaccgcgatcgac
cagggcgcacccgtaccggatgtagtcctcgccgactgccgatcggccgggaccgacgcc
gcctccgtccacacggcgacggccgccgcgctggcgctgatccagcagtggctggccgac
gaccgatacgccgacagccgaatggttttcgtgaccagcggggcggtcgaggctcacccc
ggcgagggcgtggccgacccggccggtgcggcggtgtgcggcctcgtccgctcggcgcag
tccgaacacccggaccgcttcgtcctggccgacgccgccgacccggcggaactgatcgcg
ctgctgcccgccgccacggccgcgcgcgaaccccacttcgccctccgcacaggcgaactg
ctcgcccccaggctggcccgggtcccggcccccaccgcggcggcaccgaccttcgatccg
tcgggcacggtgctgatcaccggcgcgagcggcgtcctcgccgggctgctggcccggcat
ctggtgcgcgaacacggtgtgcgacacctacttctgctcagccgccggggcccggacgcg
ccggaggccgccgggctgcgtaccgacctgaccgagctgggcgcggaggcgacattcgcc
gcctgcgatgtcgccgaccgggacgcgctggccgcggtcctggccgcggttcccgcggcg
cacccgctgacggccgtcgtccacacggcgggcgtcctggacgacggcaccgtggcggcg
ctgacccccgcgcggctcgacaccgtgctccgccccaaggtcgacggcgcgctgcacctg
cacgagctgacccgcgacctgccgctgaccgccttcctgctgttctcctccgcggcgggc
gtcatcggcaatgcgggacaggccaattacgccgccgccaatgccttcctcgacgcgctg
gccgcccgccgccgcgcccagggcctgcccgcgcacgccatcgcctggggactgtgggag
agccgcagcgaaatgaccggcgccctagacgacaccggacggcggcgcatgacccggggc
ggcgtcgcggcgctctcggacgccgcgggactggccctgttcgacgctgtgctgcaccag
gattcggccctgctggtgcccgtccgcctagacctgggccgacagcggccgacaaccgcc
gacgtgcccgccctgctgcgcggcctggtgcgcggcgtgacccggccgcgggctgccacc
gccgacgccgcggcggccgacaccctgcgtcgccgcttggccgaagccggtgcgcccgaa
cgcaagtcgctgctcgaggacctggtgcgggaccgggtcgcgcgggtgctccggcacccg
ggcggcgaggccgtcgatcccgaatcggccttctccgaactcggattcgactcgctgacc
tcggtcgagctgcgcaaccagctcaacgcggtcaccgggctgcggctgcccgcgaccctc
gtcttcgaccacccgacccccgaggccgtcgcggcctacctcgccgagcgcctggccccc
gcgccgccggacgcaccggccgccgacaccgacgatgccgcggtgcgccgcctgctggcg
acgatcccgccgcagcggctgcggtcggccgggctcctggatgcgctgctgcgcctgcgg
gatccgggaccggcgccggagccgcccgcgccggaggagacggaatcgatcagagagatg
gatgtggacggtctggtgcgcatggcgctcggtgacaaccgtgcctga

DBGET integrated database retrieval system