KEGG   Nocardia terpenica: CRH09_35075Help
Entry
CRH09_35075       CDS       T05168                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
ntp  Nocardia terpenica
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ntp01007]
    CRH09_35075
Enzymes [BR:ntp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     CRH09_35075
Amino acid related enzymes [BR:ntp01007]
 Aminotransferase (transaminase)
  Class III
   CRH09_35075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATL70623
UniProt: A0A291RSY5
LinkDB All DBs
Position
complement(7883508..7884833)
Genome map
AA seq 441 aa AA seqDB search
MTSSAVESRSARDFWADAERHLVRYAGAGDFTREIITRAAGSFVYTESGREILDFTSGQM
SAILGHSHPEIVATVRRQIGELDHLFSGMLSRPVVDLARRLSETLPASLSKAQLLTTGAE
ANEAAIRMAKLVTGRHEIVSFARSWHGMTQAAASATYGAGHQGYGPGAPGNFAIPVPNAY
RPDFTTATGELDWRRQLAFAFDLIDAQSTGSLAACIVEPILSSGGVIEPPAGYFAALRDK
CHERGMLLILDEAQTGLCRTGSWYAFERDGIVPDILTLSKTLGAGLPLAAVLTSAEIEER
AHELGYLFFTTHVSDPLVAAVGNTVLDVLQRDRLDARAAALGDFLRTGLRRLAERHAVVG
DIRGRGLLLGLELVTDRETKTGADELGARVTRRCLELGLHMNIVQLPGMGGVFRIAPPLT
ATEDELALGLSILDQALDDSL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctccgccgtcgaaagccggtcggcccgggacttctgggccgatgccgagcgg
catctggtgcgctacgccggtgccggtgacttcactcgcgagatcattacccgggccgcc
gggagcttcgtctacaccgagagtggccgggagatcctggatttcacctccgggcagatg
agcgcgattctggggcattcgcatccggagatcgtcgccaccgtgcggcgccagatcggc
gagctcgatcatctgttcagcggcatgctgagccgcccggtcgtggacctggccagacgc
ctgtccgagacgctgcccgcgtcgctgtccaaggcgcagctgctgaccaccggggccgag
gcgaacgaggcggcgatccggatggcgaagctcgtcaccggcaggcacgagatcgtctcg
ttcgcccggtcctggcacggcatgacgcaggcggcggcgagcgccacctacggcgcgggc
caccaggggtacggtcccggtgcgccgggaaacttcgccatacccgtgccgaatgcgtat
cggcccgatttcaccactgccacgggcgaactcgactggcggcggcagctcgccttcgcc
ttcgacctgatcgatgcgcagtcgaccggtagcctggccgcctgcatcgtcgagccgatc
ctgagctccggcggcgtaatcgagccgcccgcagggtatttcgcggcgctgcgcgacaaa
tgccacgagcgggggatgctgctgattctcgacgaggcccagaccggcctgtgccgcacc
ggatcctggtacgcgttcgagcgcgacgggatcgtgccggacattctcacgctgtccaag
accctcggcgcagggctgccgctggcggccgtgctgaccagcgcggagatcgaggagcgg
gcgcacgaactcggatacctgttcttcaccacgcatgtctcggacccgctggtcgcggcc
gtcgggaacaccgtgctggatgtattgcagcgcgaccggctcgacgctcgcgcggccgcc
ctcggtgattttctgcgcaccggcctgcggcgtctcgccgagcggcatgcagtggtcggc
gatattcgcgggcgcggtctactgctcggtctggagctggtaacggaccgcgaaaccaag
acgggcgcagacgaactcggcgcgcgggtcacgcggcggtgtctggagctgggcctgcac
atgaatatcgtccagctgcccggcatgggcggcgtgttccggatcgccccgccgctcacc
gctacggaagacgaactggcactgggtctttcgattctcgatcaggcgctggacgactcc
ttgtga

DBGET integrated database retrieval system