KEGG   Nocardia terpenica: CRH09_36985Help
Entry
CRH09_36985       CDS       T05168                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ntp  Nocardia terpenica
Pathway
ntp00330  Arginine and proline metabolism
ntp01100  Metabolic pathways
ntp01110  Biosynthesis of secondary metabolites
ntp01130  Biosynthesis of antibiotics
ntp01230  Biosynthesis of amino acids
Module
ntp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ntp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CRH09_36985
Enzymes [BR:ntp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CRH09_36985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored GFO_IDH_MocA TrkA_N NAD_binding_2 NAD_Gly3P_dh_N Sacchrp_dh_NADP Shikimate_DH NAD_binding_7 CoA_binding_2 CoA_binding
Motif
Other DBs
NCBI-ProteinID: ATL70953
UniProt: A0A291RTW7
LinkDB All DBs
Position
complement(8281535..8282353)
Genome map
AA seq 272 aa AA seqDB search
MTRIAVIGGGRIGEALLAGLLESGRQSKDLVVVEPVPVRAEFLAERFGIRATDSVTDAVT
GADVLIIAVKPNDVDGVLTELGKAALDGDRDQVLVSLAAGVPTARVEAKLPAGFSVVRAM
PNTPMLVGQGMCAIAPGRFARSEHLSLVTELLEAVGKVVTVAEHQMDAVTAVSGSGPAYF
FLVVEAMIEAGVGLGLTHEVANQLVVQTMLGSAALLDESGQDPGELRAAVTSPAGTTAAA
VRELERGGVRSAFWEALHAARRRSAEQGATSD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaattgcggtgatcggtggcgggcggatcggggaggcgttgcttgcggggctg
ctcgaatccgggcggcagagcaaggatctggtcgtcgtcgagccggtgccggtgcgggcc
gaatttctcgccgagcggttcggcatccgggccaccgacagcgtcaccgacgccgtcacc
ggggccgacgtgctgatcatcgcggtgaagccgaacgatgtcgatggtgtgctcaccgaa
ctgggcaaggccgccctcgacggcgaccgcgatcaggtgctggtctcgctggccgccggg
gtgccgaccgcgcgggtggaggcgaagctgcccgccggattctcggtggtgcgggccatg
cccaacacacccatgctggtcggccagggcatgtgcgcgatcgccccgggccggttcgcg
cggtcggagcatctgagcctggtgaccgagttgctcgaggcggtcggcaaggtggtgacc
gtcgccgagcatcagatggacgcggtgaccgcggtgtccggctcgggcccggcctatttc
ttcctggtcgtggaggccatgatcgaggccggggtcggcctcgggctgacccacgaggtg
gccaatcagctggtggtgcagaccatgctgggctccgcggccctgctcgacgagtccggg
caggaccccggcgaactgcgggccgccgtcacctcgcccgcgggcaccaccgccgccgcg
gtccgcgagctcgagcgcggcggagtgcgctcggcgttctgggaggcgctgcacgccgcc
aggcgacgctccgcggaacagggcgcaacgagcgattga

DBGET integrated database retrieval system