KEGG   Novibacillus thermophilus: B0W44_01690Help
Entry
B0W44_01690       CDS       T04694                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ntr  Novibacillus thermophilus
Pathway
ntr00473  D-Alanine metabolism
ntr01100  Metabolic pathways
ntr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0W44_01690
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    B0W44_01690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ntr01011]
    B0W44_01690
Enzymes [BR:ntr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B0W44_01690
Peptidoglycan biosynthesis and degradation proteins [BR:ntr01011]
 Precursor biosynthesis
  Racemase
   B0W44_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AQS54684
UniProt: A0A1U9K3T4
LinkDB All DBs
Position
306572..307720
Genome map
AA seq 382 aa AA seqDB search
MLDSFYRDTVAEIDLDAVAHNVRAFRAWLPPRTAIMATVKANGYGHGAEPVAREALDNGA
TFLGVATLDEAIELQDAGIRAPILVMGYIPVRGLAEAIARKIRITVYDPDHAAQVKEASA
AVGKRAVVHLKADTGMGRLGVRLHEVPPLVEQLLDTRFFELEGLFTHFARADERDKQYTH
WQANNLKMILQKCKRMGASFSLVHCGNSAAAIDLPQYGFNMVRIGISLYGLYPSAEVKRQ
NVALKPVMSLKTKIVHVKRVQAGTGISYGSTYRTKKEETIATLPIGYADGYNRLLSNRGQ
ALVQGKRVPIVGRICMDQTMLALPDGLKARVGDEVVLYGKQGGEELPVDEVAKWLGTINY
EVTCMVNRRVPASTCETAARSR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgctagattcgttttatcgtgacacagttgcggaaattgacttagatgctgtcgctcac
aatgtccgcgcatttcgcgcctggctgcctccccgtacagctatcatggccaccgtgaaa
gcgaacggatacgggcacggagcggagccggtggcacgggaagcgcttgacaacggtgcg
actttcctcggtgttgccacgctggacgaggcaatcgaactgcaggacgcagggatccgc
gctcccatcctcgtcatgggatacatcccagtacggggtttggccgaggcgattgcgaga
aagatccgcatcactgtctacgatcctgatcacgcggcccaagttaaagaagcatcggcc
gccgttgggaagcgggccgtcgtacacctgaaagccgacacgggaatggggaggttgggg
gtccggttacatgaagttccaccgttagttgaacagttgctagatactaggttcttcgag
ctggaagggttgtttacgcattttgcgcgcgccgacgagagagataaacagtacacccat
tggcaggcgaacaaccttaaaatgattttacaaaagtgtaagcgtatgggggcgtctttt
tcactcgtccattgcgggaacagtgctgctgccatagatttgccccagtacggcttcaac
atggtgcggattggcattagcttgtacgggctttacccgtctgccgaagtgaagcgacaa
aacgtggcgttaaaacccgtcatgtcgctcaagacgaaaatcgtccacgtaaagcgcgtt
caagcgggaacgggtatcagctacggatcgacctaccgtacgaaaaaggaagaaacgatc
gcgacgttacccatcggctacgccgatggatacaaccgccttctctctaaccgcggccag
gccctcgtccaggggaagcgcgtgcccatcgtcggacgaatatgtatggatcagacgatg
ctcgccttgccagacggattgaaggcccgcgtcggggatgaagtcgttttgtacggcaag
cagggaggcgaagagttgcccgtcgacgaagtcgcgaaatggttaggaacgatcaactac
gaagtgacgtgtatggtgaatcgcagggtccccgcgtctacatgcgaaacggccgcccgg
tcgaggtga

DBGET integrated database retrieval system