KEGG   Novibacillus thermophilus: B0W44_02075Help
Entry
B0W44_02075       CDS       T04694                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ntr  Novibacillus thermophilus
Pathway
ntr00970  Aminoacyl-tRNA biosynthesis
ntr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B0W44_02075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ntr03029]
    B0W44_02075
Enzymes [BR:ntr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     B0W44_02075
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     B0W44_02075
Mitochondrial biogenesis [BR:ntr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B0W44_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF2420
Motif
Other DBs
NCBI-ProteinID: AQS54738
UniProt: A0A1U9K3X6
LinkDB All DBs
Position
389836..390126
Genome map
AA seq 96 aa AA seqDB search
MSISKEEVRHVAELARLSLTEEETETFSLQLSDILDFAGKLNELDTEEVEPTSHVLPIQN
VLREDEVRPSWPREKVLSNAPDVEAGQFKVPAILEE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatttcaaaagaagaggtgcggcacgtggccgaactggctcgtttgtcgctcact
gaggaagaaactgagacgttcagccttcagttgagtgacattctcgattttgccgggaaa
ttaaacgaattggatacagaagaggtagagccgaccagtcatgtgctgccgatacagaac
gtcttgcgagaggacgaagtacgcccttcatggccccgtgaaaaggttttgtccaatgct
cccgatgtcgaggccgggcagtttaaagtgccagccattctggaggagtag

DBGET integrated database retrieval system