KEGG   Novibacillus thermophilus: B0W44_04415Help
Entry
B0W44_04415       CDS       T04694                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ntr  Novibacillus thermophilus
Pathway
ntr00564  Glycerophospholipid metabolism
ntr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B0W44_04415
Enzymes [BR:ntr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B0W44_04415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 GIDA GDI 3HCDH_N FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AQS55126
UniProt: A0A1U9K530
LinkDB All DBs
Position
895862..897517
Genome map
AA seq 551 aa AA seqDB search
MSFSYQTRNRLIQDMDKTKYDLLVIGGGITGCGIALDAVLRGLNVVLVDQGDFAGGTSSR
STKLVHGGLRYLAKGEIRLVREAGRERNALLNIAPHLVTPMPFIIPTSRKLAGAMSYYPM
TLGLRLYDHLADVRRYERRVMLKPDQIEQAEPMLAGADMVGGGRYYEYVTDDARLTLEVA
KTAHENGGHVLNYVEVVDLVITNGRCHGAKVRDVLSGKEWEIQAETVVNAAGPWVDDIRR
KDAVRPRGKRLFHSKGVHIVLDRRELPVTHAVTLLPSDGRIVFVIPRGRFTYVGTTDTSY
RGDLRNPVPTQEDVAYLIDVLNEGFPKHSFNKSQVLSSWAGIRPLIHEEGKKPGEISRAD
EMITSETGLISIAGGKLTAYRKMAERVVNHVIRVLQAKGRATRVKPCQTLTTPLTGVKGI
AGTFESFKLRKRAELEQKGFQRETAERLVTTYGRHVDLVVAIHEEDDEQFHRDLLAADVR
YAVWHEQALTVCDVLERRHPLFLFSHDQGRSAIEPVAKLMGDMLGWSPTRIHEEIWKAQE
SVERRNKWKGE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcctatcaaacgcgaaatcggctgattcaggacatggacaaaacgaagtac
gacctgctcgtcatcggtggtggaattaccggttgtggcattgcgttagacgccgtgctt
cgcggcttaaatgtcgtcttggtcgatcagggggactttgccgggggaacgagcagccgt
tcgacgaaactcgtacacggtggactgcgctatttggccaaaggagagattcgtttagtc
cgcgaagctgggcgagagcggaacgcgttgttgaatattgcgccccatcttgtgacgccg
atgccgtttatcatcccgaccagtcgcaaattggcgggggcgatgtcgtactacccgatg
acgctcggactgcggttgtacgaccatctggccgacgtgcgccggtatgagcggcgtgtc
atgctgaaaccggaccaaatcgaacaagcagagccaatgcttgccggtgcggatatggtt
ggcggcggcagatattacgaatacgtcacagacgacgcccgcctcacgttagaagtggct
aagacggcacatgaaaacggcggacacgtgctcaattacgttgaggttgtagatcttgtc
atcacaaatgggcgttgccacggggcgaaagtgcgcgatgtgctgtccggcaaggaatgg
gagattcaagcagaaacagtggtgaatgccgcagggccttgggtcgatgacattcgccgc
aaagacgctgttcgtcctcggggtaagcgtctgtttcattccaagggcgttcacattgtg
ttggaccgccgagagcttcctgtcacccatgcggtgactcttctgccttccgacggaaga
atcgtgtttgtcatcccccggggccgctttacgtacgtcggtacgacagacacatcctac
cgcggtgaccttcgcaaccctgttccaacgcaggaagatgtggcgtatttgatcgatgtg
ttaaacgaagggttcccgaagcattcgtttaataagagccaagtcttgtcttcgtgggcg
ggcattcgtcccctcattcacgaagaggggaaaaaaccgggggaaatttcccgcgcagac
gaaatgataacgagtgagaccggtctgatttccattgctgggggtaaattgacagcttac
cgtaaaatggcagaacgcgtcgtcaatcacgtgatccgagtgcttcaagcaaaagggcgg
gccacacgtgtgaaaccgtgtcagaccctcacgacacctttaaccggtgtgaaggggatc
gcgggaacatttgaatcgtttaaattgaggaaaagagctgaattagagcaaaaagggttt
caaagggagacggccgaacgattggtgacgacatacgggcgacatgtggatctcgtggtg
gcgattcacgaggaagacgatgaacagttccaccgcgacttgttggcggctgacgtccgt
tacgccgtctggcacgagcaggcgttaacggtgtgcgatgtgctagagcgccgccatccc
ctgttcttgttttctcacgaccaggggcgttccgccattgaaccggttgcgaaactcatg
ggcgacatgttaggctggtctcccaccaggatccatgaggagatatggaaggcgcaggag
tctgttgagagacggaacaagtggaaaggggaatga

DBGET integrated database retrieval system