KEGG   Novibacillus thermophilus: B0W44_10495Help
Entry
B0W44_10495       CDS       T04694                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
ntr  Novibacillus thermophilus
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B0W44_10495
Enzymes [BR:ntr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     B0W44_10495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AQS56129
UniProt: A0A1U9K7U7
LinkDB All DBs
Position
2137764..2138858
Genome map
AA seq 364 aa AA seqDB search
MGVKTELPRELPKKMKAVVAYAPGDYRLEEVDTPKAGPGEIVIKVEACGICAGDLKAYDG
APSFWGDETQPAYIKAPVIPGHEFVGHVVQTGEGVEGFSFGDRVISEQIVPCWKCRFCQR
GQYWMCEKHDLYGFQYNVNGGMAEYMKFTKEAINYRVPDHLTLEQAVLIEPYACSLHAIQ
RAQIQLGDFVVLSGAGTLGLGMVGAARRSGPGKLVVLDLIDERLKLAQKFGADVVMNPLK
VDVVSEIKNMTDGYGCDIYIEATGHPKSVEQGLSMIRKLGRFVEFSVFKDPVTVDWSIIS
DRKELDLLGSHLGPYCYPIVIDGIERGYLPTEGVVTHQLPLDQFERGFELVKSGKHSIKV
VLIP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcaaaacggaacttccacgcgaacttcccaaaaagatgaaagcagtggtcgca
tacgcgccaggtgactatcggctggaagaggtggacacgccgaaagcggggccgggggag
attgtcatcaaagtggaagcgtgcggcatttgtgccggtgatttgaaagcgtacgatggg
gctccaagtttttggggagatgagactcagcccgcctacataaaggctcccgtcatcccc
gggcatgagtttgtcgggcatgtcgtacagacgggagagggggttgaaggtttttccttt
ggagaccgcgtcatttcagagcaaattgtgccgtgttggaaatgccgcttttgtcagcgc
gggcagtactggatgtgcgagaagcacgacttatacggctttcagtacaacgtcaacggc
ggaatggctgagtatatgaaatttacgaaagaggcgattaattatcgagttcctgaccac
ttaacgctggaacaggcggtactgattgaaccgtatgcctgttcattgcacgccatacaa
cgtgcccagatacaattaggggattttgtcgtcttgtcaggtgccggaacgttgggattg
ggcatggtcggagcggccagaaggtctggtcccggaaagttagttgtacttgacctcatc
gacgagcggctgaaactggcccaaaaattcggagcggacgtcgtcatgaacccgctcaaa
gtggatgtcgtttcagagatcaaaaacatgacagacggctacgggtgtgacatttacatt
gaagctaccggacatccgaagtcagtcgaacaagggctttcgatgattcgcaaattgggg
aggttcgtcgagttcagtgtgtttaaagatccggtgacggttgactggagcattataagt
gaccggaaagaactggatcttttaggttctcacttgggaccgtactgttatccgatcgtc
atcgacggcatcgaaaggggctatttgccgacagaaggcgtcgtgacgcatcaactgccg
ttagatcaattcgaacgaggtttcgagttggtcaagagcggtaagcactccattaaagtc
gtattaattccgtaa

DBGET integrated database retrieval system