KEGG   Novibacillus thermophilus: B0W44_16385Help
Entry
B0W44_16385       CDS       T04694                                 

Definition
(GenBank) hypothetical protein
  KO
K13626  flagellar assembly factor FliW
Organism
ntr  Novibacillus thermophilus
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:ntr02035]
    B0W44_16385
Bacterial motility proteins [BR:ntr02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    B0W44_16385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliW
Motif
Other DBs
NCBI-ProteinID: AQS57094
UniProt: A0A1U9KAM5
LinkDB All DBs
Position
complement(3357251..3357703)
Genome map
AA seq 150 aa AA seqDB search
MTHYQTAYMGEVDIPDDDQIVFPAGLPGWPDRTRFAVLFHEEMWPFYHLQSLEEAQLCFL
TVDPFAFFRDYDFQLPEAIVEQLEIHAPEDIWVRNIVVVAEDFRQSTVNLQAPVVINHRR
RLGRQVILNDSRYAVKHPLFSKQAAGSGER
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacccactatcagactgcttacatgggggaagtggacataccagacgacgaccagatc
gttttcccggcaggtttgccggggtggcctgaccgcacccgttttgcggtcctttttcat
gaggagatgtggccgttctaccacttgcagtcccttgaggaggcacagttgtgctttttg
accgtcgatcctttcgcgtttttccgtgattacgacttccaactgccagaagcgatcgtc
gagcaattggagattcacgcgccggaagacatctgggtgcggaatatcgtcgtcgtcgca
gaagacttcagacagtccaccgtcaatctgcaagctccggtcgtcatcaatcaccgccgc
cggttagggcggcaggtcattttgaacgattcgcgctacgccgtcaaacacccgctgttc
tccaaacaggcggcaggaagcggggaacgctga

DBGET integrated database retrieval system