KEGG   Novibacillus thermophilus: B0W44_16695Help
Entry
B0W44_16695       CDS       T04694                                 

Definition
(GenBank) ABC transporter substrate-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
ntr  Novibacillus thermophilus
Brite
KEGG Orthology (KO) [BR:ntr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ntr02000]
    B0W44_16695
Transporters [BR:ntr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    B0W44_16695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 ZinT YhfZ_C
Motif
Other DBs
NCBI-ProteinID: AQS57141
UniProt: A0A1U9KAX1
LinkDB All DBs
Position
complement(3428565..3429410)
Genome map
AA seq 281 aa AA seqDB search
MFQRKYWGLACVLLLSVVVIACGSADSESGAAGGSGAEVTGEESADQETEGAVENDKVFT
FAMSGLYPPFNYQEGGELVGFDVEIGQALAEKMGMEAEPVTNPWQTILAALNSGKFDAII
GSMAITEEREKEADFSNPYYESGAQIFVAEDNDAIQSEEDITGKKIGVVVSSTFEEVAKE
YTDHVDTYDSDVTALQDLLVKGRLDAVITDELVGKHAIHANGLDIKPVGDPLYVDQMGIP
VQKGNEELLEKINKALEEIMNDGTYAEISEKYFGEDISKDL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcgaaagtattggggtcttgcttgtgtgttactgttgtctgtcgtcgtcatc
gcttgcggcagcgcagacagtgagagcggagcagcaggcggcagcggggcggaggtgaca
ggtgaggaaagtgctgaccaggagacagaaggcgcagtggaaaatgacaaagtgtttacg
tttgccatgagcggtctgtaccccccttttaattaccaagaaggcggcgagttagtcgga
tttgacgtagaaattggacaagctctcgctgaaaagatggggatggaagccgaaccggtc
acgaatccgtggcagacgattttagccgcactgaattcaggcaagtttgacgccatcatc
ggcagcatggcgataacggaagaacgagaaaaagaggcggatttttccaacccgtactat
gaatccggtgcccaaatatttgtcgcggaagacaatgacgcgattcagtcagaagaagat
ataaccggtaaaaagatcggggtcgtcgtttccagcacgtttgaagaagttgcgaaagaa
tacacagatcacgttgacacttacgacagtgacgtgacagcacttcaagacttgttagtc
aaaggccgtctcgatgccgtcattaccgacgagctggtcggaaaacacgccatacacgca
aacgggcttgatataaagcctgtcggggaccctttgtacgtcgatcaaatgggaattccc
gtacaaaagggcaacgaggaactgttggagaaaatcaataaagcgctggaagagatcatg
aacgacggcacgtacgctgagattagcgagaaatactttggagaagacatctctaaagac
ctataa

DBGET integrated database retrieval system