KEGG   Candidatus Nitrosoglobus terrae: TAO_0229Help
Entry
TAO_0229          CDS       T05173                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ntt  Candidatus Nitrosoglobus terrae
Pathway
ntt00473  D-Alanine metabolism
ntt00550  Peptidoglycan biosynthesis
ntt01100  Metabolic pathways
ntt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ntt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    TAO_0229
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TAO_0229
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    TAO_0229
Enzymes [BR:ntt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TAO_0229
Peptidoglycan biosynthesis and degradation proteins [BR:ntt01011]
 Precursor biosynthesis
  Amino acid ligase
   TAO_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATPgrasp_Ter CPSase_L_D2 ATP-grasp_3 TTL ATPgrasp_ST RimK ATP-grasp ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: BAW79599
UniProt: A0A1Q2SKF3
LinkDB All DBs
Position
238147..239073
Genome map
AA seq 308 aa AA seqDB search
MMPVAADGDWGKVAVLMGGRSAEREISLKSGKAVIQALLNKDIDVHGIDVAEQVIEQLLT
GKFHRVFIALHGCGGEDGIIQGALETLGLPYTGSGVMGSALAMDKLRSKQLWRGIQLPTA
DFYILNNETDFSQVVSHLTLPLIVKPSRQGSSLGIIKVEGIKELKAAYQEAAAFDTTVFA
ERWLPGAEYTAGILAGQALPLIRLETPHQFYDFEAKYLADTTRYLCPCGLSKEREQALQT
LALESFHALGASGWGRVDFRCDEQERPYLLEVNTVPGMTTHSLVPMAAKAAGIKFDDLIL
QILESSRK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgtagctgctgatggcgactggggcaaagttgcagtgcttatgggagggaga
tccgcggagcgtgaaatttcccttaaaagtgggaaggcagtaattcaagcgcttcttaat
aaagatattgatgttcatggaattgatgtagcggagcaggtgatagagcagctattaacc
gggaagtttcatcgggtttttatagcgcttcacggctgtggtggagaggatgggattatt
caaggggccttggaaactttaggcttaccttatacgggtagtggagtgatgggatcagct
ttagctatggataagctacgaagtaaacagctttggcgaggaatacagctacccactgcg
gacttttatatattaaataatgagacagatttttctcaggtcgtatctcacctgacactc
ccccttatcgttaaaccatcacgacagggatcaagcctaggtattattaaggtggaaggt
atcaaggaattgaaagccgcttatcaggaggctgcagcttttgatacaacagtatttgct
gagcgctggcttccaggagcagagtatacagcaggtattcttgctggacaggccttaccg
cttattcgcttagaaacaccccatcaattttatgactttgaagccaaatatcttgctgat
actacccgttacctgtgcccgtgtgggctatctaaagagcgagaacaggctttacagacg
ttagcgttggagtcctttcatgcattaggagctagcggttgggggcgagtggatttcagg
tgcgatgaacaggagcgtccatatctattagaagttaataccgttccaggtatgacgact
cacagtttagtacctatggcagctaaggctgcgggtatcaagtttgatgatttgattttg
cagatattagagagcagtcgaaaataa

DBGET integrated database retrieval system