KEGG   Candidatus Nitrosoglobus terrae: TAO_0645Help
Entry
TAO_0645          CDS       T05173                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ntt  Candidatus Nitrosoglobus terrae
Brite
KEGG Orthology (KO) [BR:ntt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ntt03012]
    TAO_0645
   03029 Mitochondrial biogenesis [BR:ntt03029]
    TAO_0645
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ntt04147]
    TAO_0645
Translation factors [BR:ntt03012]
 Eukaryotic Type
  Elongation factors
   TAO_0645
 Prokaryotic Type
   TAO_0645
Mitochondrial biogenesis [BR:ntt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TAO_0645
Exosome [BR:ntt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TAO_0645
  Exosomal proteins of breast cancer cells
   TAO_0645
  Exosomal proteins of colorectal cancer cells
   TAO_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAW80015
UniProt: A0A1Q2SLQ1
LinkDB All DBs
Position
685190..686380
Genome map
AA seq 396 aa AA seqDB search
MSKAKFERKKPHINVGTIGHVDHGKTTLTAALTKVLSAQYGGEFRAYDQIDNAPEERERG
ITIATSHVEYETKDRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYILVYLNKADMVDDPELLELVEMEVRELLDSYQFPGDETPIVVGSALKALE
GDETEIGVASIMKLVEAMDAYVPEPQRAIDQPFLMPIEDVFSISGRGTVVTGRAERGIIK
VGDEIEIVGIQETQKTICTGVEMFRKLLDEGRAGDNIGVLLRGTKREDVERGQVLAKPGS
ITPHTKFQAEIYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGAVDLPEGVEMVMPGDNVQ
VTVSLIAPIAMEEGLRFAVREGGRTVGAGVVSKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggcgaaatttgagagaaagaagccacatattaatgtagggacgattggccat
gtagatcatggtaagacgacgctaacggcggcattaacgaaggtattatcggcacaatat
ggtggggagtttagagcctatgatcagattgataatgcgccggaggagcgagagcgaggg
attacgatagctacatcccatgtagaatacgagaccaaagatagacactacgcgcatgtg
gattgcccgggtcatgcggattatgtaaagaacatgattacgggtgcggcacagatggat
ggagcgatactagtagtatcggcggcggatgggccgatgccacagactcgggagcacata
ctgctagcgagacaagtaggagtgccatatattctagtatatttaaataaagcggacatg
gtagatgatccagagctgctagaattggtggagatggaagtacgggagttactagatagt
tatcaatttcctggggatgagacgccgattgtagtagggagcgctttaaaggctttagaa
ggggatgagaccgagataggggtagcgtcgattatgaagctagtggaagcgatggatgct
tatgttccagagccgcagcgggcgatagatcaaccgtttttgatgccgatagaggatgta
ttttctatatctggtcgtggtacggtagttacggggagagcggaacgagggattatcaag
gtaggtgatgagatagagattgtagggatacaggagacgcagaagaccatctgcacgggt
gttgagatgtttcgtaagctgttggatgaaggtcgtgcgggagataacataggggtattg
ctgcgaggaaccaagcgagaggatgtagagcgtggtcaagtgttggctaagccggggtcg
attacaccgcatacgaaatttcaagcagaaatttatgtgctttctaaggaggagggtggg
cgtcatactccgtttttcaaaggttatcggccacagttttattttcggactacggatgtg
acgggcgctgttgatttacctgagggagtagagatggtgatgcctggtgataatgttcag
gtgacggtgagtttaatagctcctattgcgatggaagagggtttacgttttgcagttcgg
gaagggggacgtactgtaggcgctggtgtcgttagcaaaattattgaataa

DBGET integrated database retrieval system