KEGG   Candidatus Nitrosoglobus terrae: TAO_1267Help
Entry
TAO_1267          CDS       T05173                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ntt  Candidatus Nitrosoglobus terrae
Pathway
ntt00630  Glyoxylate and dicarboxylate metabolism
ntt01100  Metabolic pathways
ntt01110  Biosynthesis of secondary metabolites
ntt01120  Microbial metabolism in diverse environments
ntt01130  Biosynthesis of antibiotics
ntt01200  Carbon metabolism
Module
ntt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ntt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TAO_1267
Enzymes [BR:ntt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TAO_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAW80637
UniProt: A0A1Q2SNF9
LinkDB All DBs
Position
complement(1383248..1383682)
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNRLTQGQFSFLPDLTDEQILAQVKYALKNSWAVNVEYTDDPHPRNTYWEMFGIP
MFDLKDPAGILMEINECRKTFSNHYVRVTAYSSVRGTESPAMSFIVNRPKNEPGFGLERQ
EIDGRRVRYTVRSYATEKPEGERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaaccctggaaaccgtctaacgcaagggcagttctcttttctgcctgatttg
acggatgagcaaattttagctcaagttaaatatgcgctaaagaatagctgggccgtgaat
gtggagtatacagacgacccccatccacgtaatacctattgggaaatgtttggcattcca
atgtttgatttgaaagatcccgctggtattttgatggaaatcaatgagtgccgtaaaacg
ttctctaaccattatgttcgggtaacggcgtatagcagtgtacggggtactgagtcccca
gctatgtcgtttattgtcaatcgccctaaaaacgagcctgggtttgggctggagcggcaa
gaaatcgatgggcgacgcgtacgctatactgtacgtagctatgctacagagaagccagaa
ggcgagcggtattaa

DBGET integrated database retrieval system