KEGG   Candidatus Nitrosoglobus terrae: TAO_1267Help
Entry
TAO_1267          CDS       T05173                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ntt  Candidatus Nitrosoglobus terrae
Pathway
ntt00630  Glyoxylate and dicarboxylate metabolism
ntt01100  Metabolic pathways
ntt01120  Microbial metabolism in diverse environments
ntt01200  Carbon metabolism
Module
ntt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ntt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TAO_1267
Enzymes [BR:ntt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TAO_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAW80637
UniProt: A0A1Q2SNF9
LinkDB All DBs
Position
complement(1383248..1383682)
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNRLTQGQFSFLPDLTDEQILAQVKYALKNSWAVNVEYTDDPHPRNTYWEMFGIP
MFDLKDPAGILMEINECRKTFSNHYVRVTAYSSVRGTESPAMSFIVNRPKNEPGFGLERQ
EIDGRRVRYTVRSYATEKPEGERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaaccctggaaaccgtctaacgcaagggcagttctcttttctgcctgatttg
acggatgagcaaattttagctcaagttaaatatgcgctaaagaatagctgggccgtgaat
gtggagtatacagacgacccccatccacgtaatacctattgggaaatgtttggcattcca
atgtttgatttgaaagatcccgctggtattttgatggaaatcaatgagtgccgtaaaacg
ttctctaaccattatgttcgggtaacggcgtatagcagtgtacggggtactgagtcccca
gctatgtcgtttattgtcaatcgccctaaaaacgagcctgggtttgggctggagcggcaa
gaaatcgatgggcgacgcgtacgctatactgtacgtagctatgctacagagaagccagaa
ggcgagcggtattaa

DBGET integrated database retrieval system