KEGG   Nitrosomonas ureae: ATY38_04305Help
Entry
ATY38_04305       CDS       T04188                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
nur  Nitrosomonas ureae
Pathway
nur00970  Aminoacyl-tRNA biosynthesis
nur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nur00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ATY38_04305
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nur03029]
    ATY38_04305
Enzymes [BR:nur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ATY38_04305
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ATY38_04305
Mitochondrial biogenesis [BR:nur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ATY38_04305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALQ50525
UniProt: A0A1H2DU24
LinkDB All DBs
Position
complement(911087..912535)
Genome map
AA seq 482 aa AA seqDB search
MFNASLKQLSNQLAEKKFSSTELTTQFLRRIKQFNPEYNAFITIDEEISLAQAKAADKMI
ATGQAGPLTGIPIAQKDIFCAKGWLTTCGSRMLSNFVSPYDAGVIERFNQAGAINIGKTN
MDEFAMGSSNETSYYGMVKNPWDIAAVPGGSSGGAACAVAARLAPAATGTDTGGSIRQPA
ALCGISGIKPTYGLVSRYGMIAFASSLDQGGPMAKSAEDLALLLNVMTGFDPRDSTSLRR
DAEDYTQDLQKPLAGLRIGLPKEYFAEGMSQDVANAIEKALIEYRKLGAQTVEVSLPNAP
LSIPVYYVLAPAEASSNLSRFDGVRYGYRAPSYSDLADMYRKTRAQGFGAEVKRRILIGT
YVLSHGYYDAYYIKAQKLRRLIAQDFTEAYKQCDIIMGPTTPTVAFNLGEKSGDPIQMYL
SDIYTSAANLAGMPAMSIPIGFGDKNRPIGLHIMGNYFKEAQMLNIAHQYQLVTDWHLKL
PV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatgccagtcttaaacagctctcaaaccagcttgccgaaaaaaaattttccagc
actgaattaaccacccaattcttgcggcgcattaaacaatttaatcctgaatacaacgct
tttattacgatcgacgaagaaataagccttgcccaagcaaaagcggcagacaaaatgatt
gccacggggcaggccggtccattaaccggaattccaattgcgcagaaagatattttttgc
gccaaaggctggctgactacatgcggctcaaggatgctgtcaaattttgtttcaccgtat
gatgccggtgtcattgaacgtttcaatcaggctggcgcgatcaatatcggtaaaaccaac
atggatgagttcgccatgggatcaagcaatgaaacatcctattatggcatggtaaaaaac
ccctgggatattgcggcagtgcctggcggcagttcaggcggggcggcgtgtgccgttgca
gcccgattagcacccgcggcaaccggtaccgatacgggcggttcgattcgccaacccgca
gcattatgcggtatttccggaattaaaccgacctatggattggtgtcgcgctacggcatg
atcgcctttgcctccagtttggatcagggtggaccgatggctaagtcagccgaagacctg
gcgttattgctgaatgtcatgaccggattcgatccgcgtgattccaccagcttgcggcgg
gatgcagaggactacacgcaggatttgcagaaacctttagccggtttgcgcattggtcta
ccgaaggaatattttgccgagggcatgagccaggatgtcgcaaacgcgatcgaaaaggct
ttaatcgagtatcgtaaattgggcgcgcagactgtcgaagtttcattacccaatgcacca
ttgtcgattccggtttattatgtgttggcgcctgcagaagcatcgagcaatttatcccgt
ttcgatggggtgcgctacggttatcgtgccccatcatacagcgatctggcggacatgtac
cgcaaaacgcgtgcacaaggttttggcgcggaagtgaagcgacgaattctaatcggtact
tatgtgttgtcgcatggttattatgatgcctactatatcaaggcgcagaaactgcgccgc
ctgatcgcacaagattttactgaggcctataaacaatgcgatatcattatggggcctacc
actcctaccgtcgcatttaatctgggagaaaaaagcggtgatccgatccaaatgtattta
tcggatatctataccagtgcggcaaacctggccggaatgccggcgatgtcgatcccgatc
ggttttggtgacaaaaaccggcccatcggtttacacatcatgggtaattattttaaggaa
gcacaaatgctgaatattgcgcaccaatatcaattggtgacagactggcatttgaagttg
cctgtttaa

DBGET integrated database retrieval system