KEGG   Nitrosomonas ureae: ATY38_04330Help
Entry
ATY38_04330       CDS       T04188                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
nur  Nitrosomonas ureae
Pathway
nur00550  Peptidoglycan biosynthesis
nur01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nur00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ATY38_04330
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ATY38_04330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nur01011]
    ATY38_04330
Enzymes [BR:nur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ATY38_04330
Peptidoglycan biosynthesis and degradation proteins [BR:nur01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ATY38_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ALQ50530
UniProt: A0A1H2DUB4
LinkDB All DBs
Position
915596..917509
Genome map
AA seq 637 aa AA seqDB search
MRQRVELRNHPVELHKFRMRLTVSAGFVLVLFLLLYARFYFLQVVQQEHYHTLAEANRIS
IAPLVPYRGLISDRNGRILAQNYSAYTLEVVPSKIQDLETTLNELAAIIEITPTDRQRFK
KLLKESKRFKSLPIRNRLTEVEIATFAANRYRFPGIEIKAQVYRQYPEKEMVSHVVGYIS
RINDQDLEQLESNGELHNYRGSHHIGKIGIEQSYEKQLHGITGFEEVETDAAGRSIRILS
RTPPTPGNNLILTLDLGLQEIAEMAFGDRRGALVALDPNNGEVLAFVSKPGYDNNLFIGG
IDQESWNSLNNSIDRPLNNRALRGVYPPGSTFKPFMALAALELEKRTAEYSMSDPGYFSL
PGVSRRYRDWKPGGHGRVDLHKSLVVSCDTYYYSLANDLGIDNIHNFISQFGLGRKTGID
IEGEVSGLLPSSAWKMRQHKQKWYAGDTISVSIGQGYNLTTPLQLAFATMIIANNGKAYL
PRLVKQIQNSQTGEVEDIPAKLLYSLNLKPKNLEVVKSALVDVTRPGGTAAKAGANADYT
FAGKTGTSQVVGIKQGERYNEKLINERHRDHAMFIAYAPAENPIIALAILVENTGTGGST
AAPIARQVFDYFLLGKLPEADLAHLIDPIKNHVHDHL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacgtgtagaactaagaaatcatccggttgagctgcacaaatttcgtatgcgg
cttactgttagcgcaggctttgttcttgttctgttcctgttgctttatgcacgcttctat
ttcttacaggttgttcagcaggaacactaccatacgctggcagaagcaaatcgtatctcc
attgcaccactggttccctatcgggggttgatttctgatcgaaacggaagaatattggca
caaaattattcagcatatacgttggaagttgtacccagtaaaattcaggatcttgaaacg
acgctgaatgaattggcggcaatcattgaaatcaccccgactgatcgtcagcggttcaaa
aaattgctaaaagagagcaagcggttcaagagtctgcctatcaggaatcgtttaacagag
gttgagattgcaacttttgcagccaatcgctaccgtttccctggtatcgaaatcaaagcc
caagtatatcgtcaatatcccgaaaaggagatggtttcacatgtggttggctatatcagc
cgtatcaatgatcaagatctcgagcaactggaaagtaatggcgaacttcataattatcgc
ggctctcatcacattggcaaaattggtattgagcagagttacgaaaaacaactgcatggc
atcacaggatttgaagaagtagaaacggacgcagcgggccgctccattcgaattttgtca
cgaacaccacccacgcccggcaataatttaattcttacgttagatcttggcctgcaggaa
attgctgaaatggcattcggtgatcgccgcggtgcactggtcgctttggatcccaataat
ggagaagtgcttgctttcgtcagcaaaccgggttatgacaataatctctttatcggcggc
attgatcaggaaagctggaattcgcttaacaattcaattgatcgccctctcaataaccga
gcactgcgaggtgtatatcctccaggatcaacctttaagccctttatggcacttgccgca
cttgaactggaaaaacgcacggctgaatatagcatgagcgatcccggatatttttccttg
cctggcgttagtcgacgctaccgggactggaaaccggggggacatggcagagtcgatttg
cacaagtctttagtggtttcttgcgatacctattactacagtcttgccaacgatctcgga
atagacaatatccacaattttatcagtcaatttggattaggaaggaaaacaggtattgac
attgaaggagaggtgtccgggttattgccttcttctgcttggaagatgagacaacataaa
caaaaatggtatgccggggatactatttctgtttccattgggcagggatacaatttgact
acaccccttcagctcgctttcgccacgatgatcatcgcaaataatggtaaagcctattta
cctcgcttggttaaacaaattcagaatagtcaaaccggggaagttgaggatatccctgca
aaactgctttatagtttaaatcttaagcctaaaaatcttgaagttgttaaaagtgcgctt
gtcgatgttacccgtcctggaggaactgctgcaaaagcaggcgctaatgcggactatact
tttgccggcaagaccggcacatcacaagttgtcggtattaaacagggagaacgctacaat
gaaaaactgatcaatgaacgtcaccgtgaccatgcaatgtttatcgcctatgcaccagca
gaaaaccccataattgctttggcaattctagtcgaaaatacgggtaccggcggttcaact
gcagcacctattgcaagacaagtatttgattattttttattagggaaattacctgaagca
gatcttgcacatctgattgatccgatcaaaaatcacgtgcatgatcatctctga

DBGET integrated database retrieval system