KEGG   Nitrosomonas ureae: ATY38_05755Help
Entry
ATY38_05755       CDS       T04188                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nur  Nitrosomonas ureae
Pathway
nur00630  Glyoxylate and dicarboxylate metabolism
nur00710  Carbon fixation in photosynthetic organisms
nur01100  Metabolic pathways
nur01120  Microbial metabolism in diverse environments
nur01200  Carbon metabolism
Module
nur_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ATY38_05755
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ATY38_05755
Enzymes [BR:nur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ATY38_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ALQ50780
UniProt: A0A0S3AHZ4
LinkDB All DBs
Position
complement(1245739..1246173)
Genome map
AA seq 144 aa AA seqDB search
MMTNQGNIVTQGQFSFLPPLTDKQISAQLKYALKNGWAIGIEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILLEINSCRKTFPNHYIRVTAFNSTRGVESPTMSYIVNRPKKEPGFSLVRQ
EGAGRSVSYTIHSYATDKPEAERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgactaatcaaggtaatatagttacacagggacaattttctttcctgcccccgctg
accgataagcaaatctcggcacagcttaagtacgcgctgaaaaatggctgggcaatagga
attgaatataccgatgatcctcatccacgcaatacctattgggaaatgttcggcaatcca
atgtttgatttgaaggatccggcaggaattttgctggaaatcaatagttgccgcaaaact
tttccaaaccactatattcgcgtgactgcatttaactcgacacgcggtgtggaaagtcca
accatgtcgtatattgtcaacagacccaagaaagagccagggtttagtttagtacgccag
gaaggtgctggacgaagcgttagttacaccattcattcctatgcaaccgacaaaccggaa
gcagaacgttactag

DBGET integrated database retrieval system