KEGG   Nematostella vectensis (starlet sea anemone): 116612414
Entry
116612414         CDS       T01037                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
nve  Nematostella vectensis (starlet sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nve04052]
    116612414
   00536 Glycosaminoglycan binding proteins [BR:nve00536]
    116612414
Cytokines and growth factors [BR:nve04052]
 Growth factors
  Growth factors (RTK binding)
   116612414
Glycosaminoglycan binding proteins [BR:nve00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   116612414
SSDB
Motif
Pfam: FGF Fascin Ins145_P3_rec
Other DBs
NCBI-GeneID: 116612414
NCBI-ProteinID: XP_032228975
LinkDB
Position
Unknown
AA seq 224 aa
MKVLCKFKRLFTIVGFVLAALLLSNQSSYATKRPSGSPQIPPKSTPSGRYLKDFRQSTDQ
SRRPKCTRVKTTTSGSEMRLTKRHLHIYDACPTHTRRVRLFCRTGWILQGKTDKKLCGTT
NTTSHQTLFDLESYGRSIVRLKHVQSQRYIAINHKGRLLMQGSLQDDSLFKTKHEENGFH
SFASRKFSLRHRHDLFIGIQKNGFCKPPKRTFPGQTAVQFIILF
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaaagttttatgcaagttcaagcgtctcttcacgattgttggcttcgtattggctgcc
ttgctactctcgaaccagtcttcttatgccacgaagcggccgtccggctcgccccagatc
cctcccaaatcaacaccgtcggggagatacctcaaagacttccggcaatcgactgaccag
tcacgtaggccaaagtgtacgagagtcaagaccaccacttccggttccgagatgcgcctg
actaagcgacatttgcatatttatgacgcatgtcctacccacactaggagggtccggctt
ttttgtcgcactgggtggatcttgcaagggaagacggacaagaagttatgcgggacgact
aacaccaccagccatcaaaccctgtttgacttggagtcgtacggaagaagtatcgttagg
ctcaagcacgtgcagagtcagcggtacatcgctataaaccataaagggcggttacttatg
cagggtagcctccaagacgatagtttattcaagactaagcacgaggaaaatggtttccac
agttttgcatctcgcaagttctcccttcgtcatcgacacgatttgttcatcggcatccag
aaaaacggcttttgtaaaccaccaaaacgaacattccctggacaaaccgctgtgcagttt
atcatactgttttag

DBGET integrated database retrieval system