KEGG   Nematostella vectensis (starlet sea anemone): 5507990
Entry
5507990           CDS       T01037                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC5507990
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
nve  Nematostella vectensis (starlet sea anemone)
Pathway
nve04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nve00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5507990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nve01001]
    5507990
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nve04090]
    5507990
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5507990
Protein kinases [BR:nve01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   5507990
CD molecules [BR:nve04090]
 Proteins
  5507990
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase fn3 APH PAN_3
Other DBs
NCBI-GeneID: 5507990
NCBI-ProteinID: XP_032232629
LinkDB
Position
Unknown
AA seq 1424 aa
MLLGKLNALNSLCSSMLILLSVALCCFPIADVLGFTNEKVLRKARCYANCLDQVPLNGTD
CSGQECMECRSPCDNPFTSLDNCIQGCSNSSSCILSCRFLDTMSNWSSIITGNGASISPS
GSAVANISMSNATLLILSWQRPVNMTRSRPVYLLKKKYKRNSVTREVELEHIFTQAESSV
PLQDVCNGVPRLTNMDTISDCTFTFVVVTLTANSSLADAPPSADVVMPKIPPLESASVVS
FSYDESHIGDKLEVTINVTPPSVYSSFITGYAFTWQGPAGTTPRIFVENTPSTNISFHIY
EKLKNSEHTLSIHSMSNCAISEVKKYKYIYQGCRFVNNFEQSLCYTFDPPPTNASERAVV
NLTISPFIASSDYTFSTRVTWSAPPYPYANVTSYEVKYGDKDNVQWGFWFPFFNNDITET
EITIANIKPDKTVIKVQVTPNLQYLIGGTRIERLINSPGLPDQELLIRYMTLGEFRYLPS
QSFSVNVTWEAPVFNYSTLDNYTVKYKKDSDGEVTFVTNTPSAELTELEHKEPFTVEVKA
VYKHNWIKTNFVTESFTAPAPSNADFLVRGLTLSTFEEDTSINEYSVVASWSPGNLPTLG
YSISYSLSGYPSNTVDCPPPSGVNRTRCKSVATNSTSYSLSGILPSEHVTITITPIFVNE
TYFNGKPSTIRSDAPAPERYVVRVRNLRYLGNPKHVAVAAKENKTLTNATNDPSTSNETL
AINQTNVNATKDENSTDISASIFAWEPPSFRHSAASAYIIRYEISSANSGKRSIATVPDK
SSTVYENRTAFLNFTAPQLEIGQQITFEVTPVFEASIIIGDRAELTISNPIVPSSKSDHG
GLSTSEIALLCTGVLILLALLILPVLWYVHRRREMIRKGLRPGANGMMIDQWEVPYEKVL
LDDELGEGAFGKVFKGTLVELPEQSSKYSIAKSMRRKSTKSLKPDDGFVVAIKMLHDMAD
EDQRSEFLKEIQLMKDVGXRNIVNMLGCCTLTEPMFLIVEYLPYGDLLHYLRKRRGKVKE
YPEDDPRGPLHSKYCDMFFNKNNPDGAQTASNARVYVNTPMDANTKKDNSGIELVSLYTG
DKPQSERGAAENDGIEDEEEDDGISSGDLMAFAWQVAQGMEYLARRGFVHRDLAARNVLV
GDNKVAKVADFGLTRHMYEDLYQGKTSRKLPLKWMSIEAIFDQAFTSQSDVWAYGVFLWE
LVTLGGTPYPTIGNRELLKLLKEGYRMEKPDMCNDDLYTIMLSCWKDKPEDRPTFENLRS
TLEDLMMRDNPYFDPSAVDESRDYYNVPSFNSAPEPDESDDVMGDLVVADSNEYKIQPPE
YSPSHSDPMAGSRSGVENIGCAASDDVLLEEAKTEKDALGSDNPNDELARDQILPSNGNN
GMGGHSQWPPKGIANDRKSLKYAQLDFEEMESRIYRHRNQGPVL
NT seq 4275 nt   +upstreamnt  +downstreamnt
atgcttctcggtaagctaaacgcgcttaactccttgtgttcatcaatgctgattctcctg
tcggttgcgctgtgctgtttccctattgctgacgttttggggttcactaatgaaaaggtc
ttgagaaaagcgagatgttacgctaactgtctggaccaggtgccgctgaatggcactgat
tgctctggacaagaatgtatggaatgtcgctctccttgtgacaacccttttacatcactg
gataactgcattcagggctgctccaattccagttcttgcatcttgagctgtcgcttcctg
gacaccatgtcaaactggtcaagcattataacagggaacggcgcttccatttctccatct
gggtcagcggtcgcaaatataagcatgtcaaacgctactcttttgatattgtcatggcaa
cggcctgtcaatatgactcggagtaggcctgtgtatctactcaagaagaaatacaaaagg
aatagtgtcactcgagaagtcgaactggaacatatattcacgcaagccgagtcttcagtc
cccctccaagatgtctgcaatggtgttccccgcctgacaaatatggacacgatctcagac
tgcacattcacgttcgtggtagtgacactcaccgctaatagttcattagcggatgcccca
ccttctgcagatgttgttatgccaaagattccgccattagagtcagcgtctgtagtgtcc
ttctcgtacgacgaaagccacattggagataaattggaggtcacgataaatgtcacgcca
ccctcagtctattcttctttcatcaccggatacgcgttcacatggcagggaccagcgggc
acaacaccaagaattttcgtggagaacacgccctcgacgaacataagctttcatatctat
gagaaattaaagaacagcgagcacactcttagtatacactccatgtccaattgcgcaatc
agcgaagtgaaaaaatacaagtacatctatcaaggttgccgttttgtgaataactttgag
cagagtctttgctatacattcgatccaccgcctacaaatgccagtgagagggctgtggtc
aacctgacgatatcaccgttcatagcatcctctgattacaccttctccacccgagtcacg
tggtctgccccgccctacccgtacgctaatgttacaagttatgaagtcaagtatggagac
aaggacaatgtgcaatggggcttctggtttcctttttttaataatgacataactgaaaca
gaaatcacaatagccaacatcaagcctgacaagaccgtgataaaagtccaggttactccg
aatctacaatacttgattggcggaactcgaatagaaaggctcattaactctccaggacta
cccgaccaggagctgttaatccgttacatgactttaggggagttcaggtatcttccaagc
caatcctttagcgtgaatgtcacgtgggaggcaccggtgtttaactacagcactttagat
aactacacagtaaaatataaaaaggacagtgacggagaagtgacgttcgttacgaataca
cccagcgccgagcttaccgaactggaacacaaagaaccatttacggttgaggtgaaggct
gtctacaaacataactggattaaaaccaattttgtgacagagagtttcacagctccggca
ccaagcaacgcagactttcttgtccgggggttaactttgtcgacattcgaagaagacaca
tccatcaacgaatacagtgtcgtggcatcctggtctcctggcaacctaccaacccttggt
tactccatatcatatagcctgtcagggtatcctagcaacacagttgactgtcctccacca
agtggagttaatagaacacgctgtaaatctgttgccacgaactccacgtcatactctctt
tcagggatcctacctagcgaacacgtgaccatcaccataacaccaatttttgttaacgaa
acgtacttcaatggaaaaccaagtacaatacgatctgatgcgcctgccccggagagatac
gtggtgcgcgtacggaacttgcgctatcttggcaacccgaagcacgttgccgttgctgca
aaggaaaataaaaccttaacaaacgctacaaatgatccaagcactagtaatgaaacccta
gcaataaatcagaccaacgtgaatgcaactaaagacgaaaacagcactgatatctcagcc
agcattttcgcctgggagccgccttcttttcgccacagcgctgcgagcgcatacatcatc
agatacgagataagttctgctaactcaggaaaacgcagcatcgctacagttccagacaaa
agttctactgtctacgaaaaccgaacggcttttttaaatttcactgcacctcagctagaa
attggacagcaaatcacattcgaggtaacgccagtttttgaagccagcatcatcatcggg
gacagagcagaattaactatttccaatccaattgttccctcgagcaagtccgaccacggt
ggcctaagtacctcggaaatcgcgttgctttgtacaggagtgcttattctgcttgcactc
ctaattctcccggtactgtggtatgtgcatagacggcgagagatgataagaaaaggcttg
agaccaggcgcaaatgggatgatgattgatcagtgggaggtaccgtacgaaaaagttctt
cttgatgatgagctcggagaaggagcttttggtaaggtgttcaagggaacgctggttgag
ctaccagagcaatcctctaaatactcaatagccaaaagcatgagacgcaaaagcaccaag
tccctgaagcctgacgacgggtttgtggtggccatcaagatgttacacgatatggcggat
gaagaccagaggagcgagttcttgaaggaaattcagctgatgaaagacgtggganaccgc
aacatcgtcaacatgctgggctgttgcacactgacggagcccatgtttctcattgtggag
tacctgccgtacggagaccttctgcactacttgagaaagagaaggggaaaggtcaaagag
tatcctgaagacgatccccgcggtccactccattccaagtattgcgacatgtttttcaac
aaaaacaatccagatggagcccagacagcaagtaatgcacgagtctacgtcaacacaccc
atggatgcgaacaccaagaaagacaatagcggcatcgagttagtatccctatacaccggg
gataaacctcaaagcgaacggggggcagctgagaacgacgggatagaagacgaagaggag
gatgacgggatttcatccggggatctgatggcttttgcctggcaagtcgcgcaaggaatg
gaatatctcgcaaggcgtggctttgtccaccgtgatctggcggctcgtaatgtgcttgtt
ggtgataacaaagtggccaaggtggcggatttcggtctgactcgtcacatgtacgaggat
ctgtaccagggcaagacgagcaggaagctgccactcaaatggatgagcatcgaggccatc
tttgatcaggctttcacctcacagagtgatgtatgggcttatggtgttttcttgtgggag
ctggtgacgctaggcgggacaccttacccgaccattggcaaccgcgagctgcttaagcta
ctgaaggaaggctaccgcatggaaaaaccggacatgtgcaacgatgacctgtatacaatc
atgttatcctgttggaaagataagccggaggacaggccgacctttgagaatcttcgctcg
accctcgaggacctgatgatgcgagacaacccgtacttcgacccgagcgccgtggacgaa
tcacgtgactactacaatgtcccatcattcaatagtgcccctgaacctgacgaatcagat
gacgtcatgggtgacttagtcgttgcggattccaacgaatataaaatccagccacccgaa
tattctccgagccattccgatcccatggcgggatcccgttcgggtgtcgagaatatcggt
tgtgccgcgagtgatgatgtgctgctcgaggaagcgaaaacagaaaaagacgcacttggc
tcagacaatccaaacgatgagctggctcgtgaccagattttacccagcaacggtaataac
ggtatgggtggtcacagtcaatggccgccaaaaggcatcgctaatgatcgtaaaagcctg
aaatatgctcaactggactttgaagagatggagtcgcgaatttatcgacaccgaaaccaa
ggaccggtcttgtaa

DBGET integrated database retrieval system