KEGG   Nematostella vectensis (starlet sea anemone): 5508136
Entry
5508136           CDS       T01037                                 

Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
nve  Nematostella vectensis (starlet sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nve04052]
    5508136
   00536 Glycosaminoglycan binding proteins [BR:nve00536]
    5508136
Cytokines and growth factors [BR:nve04052]
 Growth factors
  Growth factors (RTK binding)
   5508136
Glycosaminoglycan binding proteins [BR:nve00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   5508136
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 5508136
NCBI-ProteinID: XP_032232779
LinkDB
Position
Unknown
AA seq 243 aa
MESHQIFVLFIASIHAHGFQTEYITPSTHVSSDNKQTKPQAADQNAPARTMLKHLQHVEP
TNMQNPVSREKRQVCSCMACAERNSKNPLNIGKDIPYEAVCKVFKFLKIARKRIKVRYSR
QGQLYCKNGYLIHIDKDGRISGTTSHKDQYSALEFQSLGAGKVIIKGVVTGRYLAINDQG
LLYSTDTFHKEAIMEEKQEENFYHSFNSHRYRQPGWYVALRRNGQVKKTSVMQKAAQFLV
LYK
NT seq 732 nt   +upstreamnt  +downstreamnt
atggaatctcaccagatattcgtgctttttatagcatccatccatgcacacggatttcaa
accgaatacattactccatcaacacacgtgtcttctgacaacaagcagacaaagcctcag
gccgctgaccaaaacgcgcccgcgagaacaatgttaaagcatctccaacatgttgagcct
acaaacatgcagaatcctgtcagcagagaaaaacgacaagtatgctcgtgcatggcgtgc
gcagaacgaaactcaaaaaatccgctgaacattggaaaagatatcccgtacgaagccgtg
tgcaaggtctttaaattcttaaaaattgcgcgtaaacggataaaagtgagatatagtcga
cagggccagctgtactgcaagaatggctacctcattcacattgacaaggatggaagaatc
agcggtacgaccagtcacaaggatcagtattccgctctcgagttccagtccctcggtgcc
ggaaaagttattatcaagggcgtggtcactggacggtatcttgcaattaacgaccagggc
ttgttatattccacggatactttccataaagaagcaatcatggaagaaaaacaggaggaa
aatttttaccactcgtttaattcgcatcgataccgtcagccaggctggtacgtggctttg
agacgtaacggacaggtgaagaagacctcggtgatgcagaaagctgcgcagtttcttgta
ttgtacaaatga

DBGET integrated database retrieval system