KEGG   Nematostella vectensis (starlet sea anemone): 5513590
Entry
5513590           CDS       T01037                                 

Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
nve  Nematostella vectensis (starlet sea anemone)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 CDC24_OB3 DUF2340 Mst1_SARAH AAA_23 FERM_f0
Other DBs
NCBI-GeneID: 5513590
NCBI-ProteinID: XP_032238970
LinkDB
Position
Unknown
AA seq 500 aa
MSSQFHFSLQHNKSPASSFQFHVVSPSLASMWKLTLRVLFNLLEGFFENWLPLLLEVGII
CAERAIVRSFCLLGIRMDDDVFLGEDPLGSQGKSNPSSPRSPNNDIELRTIAGMRSKESD
LLRSVSMPDGLDVKSKGTAQQPSLMSPVKEFISNFVHRKAGKRRQIAGPSTTDDISSHQT
DQQKGRGHSFLPFSLRNPTWCDLCGEFIWGLYKQAIRCKHCKYTCHRRCRIDVDLDCLGA
WPNIVRNMSVDEVTMKTLHLLDDDDIKRNEPFTLVSTQLQQDTMRQKIEEFNAKTTGLIM
TMKEDAFQGFVRVHMNLLRPINIVAGERPLSIFEAVRSENSKKIQRTSFFLPLGTVKALH
ISSTTTVQEVIEALLKKFKVADNPRKFALFECYQEEDRHLILRRMADMERPLVLRLLWGG
GDIKHSFSLQENETGDIVWEVFSLTELQNFLRILDKEEEELIEQVKEKYQKYKERLELAM
ELQKDMKSAKSLSLKSTGSL
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtcatcacaatttcatttctctcttcagcacaacaagtcgccagcttcatcctttcaa
tttcacgtcgtctccccttcgctagcgtctatgtggaagctaactctccgagttcttttt
aatttgttagaaggattttttgagaactggctgcctttgctactggaagttgggatcatc
tgcgcagaaagagcaatagtgagatcgttttgtctgctgggaataagaatggacgacgat
gtgttccttggtgaagatcccttgggatcgcaaggtaaaagcaatccttcatctccaaga
agcccgaacaatgatatagaattgagaacaattgctggaatgagaagcaaagaatcagac
cttcttcggtccgtgtctatgcccgatggactagatgtcaaatccaaaggcactgctcaa
caaccgtcgcttatgagccctgttaaagaatttatatcaaactttgtacatcgtaaggca
gggaaacggcgccaaattgcagggccatcaacaactgatgatatcagttctcatcagacg
gatcaacaaaaaggacgaggacattccttccttcctttctcacttcggaacccaacatgg
tgtgatttgtgtggtgaattcatttggggcttgtacaagcaagcaattcggtgtaaacat
tgtaagtatacatgccatcggcgatgtcgtatagatgtcgatcttgactgtttgggtgct
tggccaaatattgtacgcaacatgtcagtggatgaagtcaccatgaaaacactacatctt
cttgatgacgatgatatcaaaagaaatgaacccttcactttggtatccacacagttacag
caagataccatgaggcagaaaattgaggagtttaatgccaaaactactggactaataatg
acaatgaaagaggatgctttccaaggttttgtcagagttcacatgaatcttttacgacca
atcaacatcgtagcaggagaaagacccctctcaatatttgaggctgttcgttcagaaaac
agcaaaaaaatacagagaacctcatttttccttcctcttggtacagtaaaagccctacat
atttcaagcactaccacagtgcaagaggtgattgaagctctgctgaagaagttcaaagtt
gcagacaatcccaggaagtttgcgttatttgaatgctaccaagaggaagacaggcatttg
attcttcggcgaatggcagatatggagaggccacttgttctacggttactgtggggtggt
ggagatatcaaacattcattttccttacaagagaatgagacaggcgatattgtgtgggag
gtgttctcattgactgaactgcagaactttctacgtatccttgacaaggaagaggaagag
ctgattgaacaggtaaaggaaaagtaccagaaatacaaggaaagattagaactagccatg
gaactacagaaagacatgaagtcagcaaaaagcttatcactcaagagtacaggctctctc
taa

DBGET integrated database retrieval system