KEGG   Nematostella vectensis (starlet sea anemone): 5514741
Entry
5514741           CDS       T01037                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
nve  Nematostella vectensis (starlet sea anemone)
Pathway
nve00230  Purine metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5514741
Enzymes [BR:nve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     5514741
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 5514741
NCBI-ProteinID: XP_032240212
LinkDB
Position
Unknown
AA seq 1130 aa
MGKTSGESRISPGSVRWAADLEDVEPTGEKHEKTKNPKMDSGKAGNNMESKKLAMNGRTE
SASKISTSSVKVAFFRDQQQSCDTSNSVWTNVRRALRLPSYKVELFSKPLEDIYHHYYEQ
QKLDRILYIILLVLLVNVALIAMYAAVFKKPSSYTQVSRLIVTGVYGAFYLLLVVLYASK
LYPARLMKCLPYLVWLGIFSQLLVDQVLGYDPLTPSDSVGMFAFFSFISYVMLPARLALC
AVFAIMISIAHLVVAGTQARMNLNYLGQQLVANTLVFVCANILGAIDYHIADRKQRRSVL
ETRESLEVKLTLDAQNQQQRRLLLSVLPKHVAEEMTKDFEGDGNPALTDNAFKKLFIRTH
DTCSILFADIVGFTELSSKCTAEQLIVTLNELFANFDKLAAKNHCLRIKILGDCYYCISG
LDDSCNHALCAVNMGLDMVEHIAHVREEKGVKSLNMRVGIHTGMVLAGVLGQRKWQFEAW
SNDVTLANHMESGGIPGRVHISEPTLNSIKDYFEVEDGDGGSRDDYLADKKIKTYLITQA
KPIWDGEKEDLDTLVLPPETSPEKRRSSSPPEVANDKDSIIGRDGNRRRTSSYMEDSEKS
DASTTSNEKMLNKLLCEVLDERTVGKIQEDMNPVTLRFKNYDVEYQYALEKQDMCSEALS
CLCIIMLCCYFVELAILPTSLRSHLVFGIGFLLMFVPTVLTFAVKFPQTCGPVLSVSYLL
EGSKPARTLVAALCVIVLAGAELIDFLDCSSRDVSSDMIRTWINQSKSLDPTSEYCEYPQ
YFSYNGILILVGISVLVQLSHALKVMLMIGVLIAYWIINLVRQDKLFVNYDKYVYFNSGS
TFVPKMYFSSVVLALTFIILALHGRQVERTARLLFLWKMEADEKKKEVEELRRINQKLLY
NILPGHVADHFLQHQNKDETDLYSHSYKRVSVMFASIPNFSEFYSEDNINNGGVECIRLL
NEVITDFDEVLADPRFLGVEKIKTISSTYMAASGLRPESEDAEESQNLVDIVDFALTLRD
KLDFINQESFNQFVLRVGICQGPIVAGVIGAKKPHYDIWGNTVNVASRMETTGKAGCIQI
TAQTYETIKDKDFVFVYRGAVRVKGKGQLITYYLTGRKNTSQVKLPNQIV
NT seq 3393 nt   +upstreamnt  +downstreamnt
atggggaaaacctcgggagaatcgcgtatttcccccggttcagtacgatgggcagccgac
cttgaggacgtagaaccgacaggagaaaagcacgaaaaaacaaaaaacccgaaaatggat
tccgggaaagcggggaacaacatggaaagcaagaaattggcaatgaacggccgcacggaa
tcggcctcaaaaatcagtacatcgagtgtcaaagtcgcatttttccgagaccagcaacaa
agctgcgatacgtctaattccgtatggacaaacgtgcgtcgtgccttacgcctgccttct
tacaaagtcgagttattttccaagccactggaagatatataccaccattattacgagcaa
cagaagctcgatcgcattttgtacatcatcctcttggttttgctggtcaatgtggcgtta
atcgctatgtacgccgccgtgttcaaaaaacctagtagttatactcaagtcagtcgactc
attgtcactggcgtttacggggccttctatctgctcttagtcgtcctttatgcctctaag
ctgtacccggcgcgactgatgaagtgtttaccgtacctcgtatggctcggcatcttttct
cagctactagtggatcaggtcttagggtacgacccgctaactccgagtgactctgtgggc
atgttcgcctttttctccttcattagttatgttatgctgccggctaggctggccctctgt
gctgtattcgccatcatgatctccattgctcatttggtcgtagcggggacgcaagcaaga
atgaatctgaactatctcggccaacagcttgtcgccaacaccttggtgttcgtgtgcgca
aatattctgggcgcaatcgattatcacatcgcagaccgtaagcagagacgatccgtcctg
gagacgagggagtctctagaagtgaagcttacattggacgcgcagaaccagcaacagagg
cgtttgctcctgtctgttttacccaaacatgtggccgaagagatgacgaaggatttcgag
ggagatggaaaccctgctcttacagacaacgccttcaagaagcttttcatcaggacacac
gatacgtgcagtatattgtttgcggacattgtgggcttcacggagttgtcatccaagtgc
actgcggaacagctgatcgttactcttaacgaactcttcgccaattttgacaaactcgcc
gcgaaaaatcactgtcttcgaatcaaaattcttggcgactgttactactgcatctcgggt
ctggatgacagctgtaaccacgcattatgcgctgttaatatgggtttggacatggtagag
catattgcccacgtgcgtgaggagaaaggcgtcaaatctctgaacatgcgcgtgggaatc
cacaccggcatggtgctggcgggggtcctggggcaaagaaagtggcaattcgaggcgtgg
tcaaatgacgtcacacttgccaatcatatggagtctggaggcattcctggtcgggtgcac
atttctgaaccgacgctgaactccatcaaagactacttcgaggtggaagacggtgacggc
gggtcacgtgacgactatctcgcggataagaaaatcaagacgtacctgataacacaagcg
aagccaatatgggacggggagaaggaggacctggatacacttgtgttaccaccggaaacc
tcacccgaaaagagaaggtcgtcttctccaccagaggtggcgaatgataaagactcaatt
atcggtcgcgatggcaacagacgcaggacctcgtcttatatggaggattccgaaaaatcg
gatgcatcaacgacgtcaaacgagaaaatgctcaataaactcctctgtgaagttctcgat
gaacgaacagtaggaaaaattcaagaagacatgaatcctgtcacgcttagattcaagaac
tatgacgtcgagtaccagtacgcgcttgaaaagcaagacatgtgctccgaagctctttcc
tgtctatgcatcatcatgttgtgctgttatttcgtagagctcgccattctgccgacgtcg
ttacgaagtcatctggtatttggtatcgggtttttattgatgtttgtccctacggtcctc
acatttgccgtcaaatttcctcagacatgtgggcctgtgctttccgtctcgtacttactg
gaaggaagcaagccagcacgcactctcgtcgctgccctatgcgtcattgtactcgctgga
gctgagcttatagactttttggattgctcttcaagagatgtctcaagtgatatgattcgc
acatggattaatcaatctaaatcactggatcccactagcgagtattgtgaatacccacag
tacttctcgtacaacggtatcctgattctggttgggatctcggtccttgtccagctaagt
cacgcgctcaaggtcatgctgatgattggtgtactcatagcctactggatcatcaacctc
gttagacaggacaagctcttcgtaaactacgacaaatatgtttattttaacagcgggtcg
acgtttgttccaaagatgtacttttcatcggttgtacttgctttgaccttcatcatcctt
gccctccacgggcgacaggttgagcgtactgcaagactgctcttcttgtggaagatggag
gcggatgaaaagaaaaaggaggttgaagagttaagacgaataaaccagaaattgttatac
aatattctacctggtcatgtggcagaccactttctgcaacaccagaataaggatgagacg
gatttatacagtcactcgtacaagcgggtcagcgtcatgttcgcctcgatcccgaatttc
tctgagttttactcagaagacaacataaataatggaggtgtagaatgtatacgtcttctc
aatgaagtcatcaccgactttgacgaggtgctggctgacccccggttcttgggcgtcgag
aagatcaagacgatcagcagtacttacatggcggcttccggtctgagacccgagtccgag
gacgcagaggaatcccaaaaccttgtggacatcgtcgacttcgcgcttactttgcgagat
aagctggactttatcaatcaggaatccttcaaccaattcgttctacgcgtcggtatttgt
caaggccctattgtagctggagtcatcggcgcgaaaaagccgcattatgatatctggggt
aacacggtgaatgtagcgagtaggatggagactacgggcaaagcgggctgtattcagata
accgcgcagacttacgagacaatcaaggataaagactttgtgttcgtgtaccgtggtgca
gtgcgcgtgaagggcaaaggtcaactcatcacctactacctgacgggaaggaaaaacacg
tcacaggtcaagctaccgaaccagatagtatag

DBGET integrated database retrieval system