KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g113343Help
Entry
NEMVE_v1g113343   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00020  Citrate cycle (TCA cycle)
nve00190  Oxidative phosphorylation
nve01100  Metabolic pathways
nve01200  Carbon metabolism
Module
nve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nve_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NEMVE_v1g113343
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NEMVE_v1g113343
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NEMVE_v1g113343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 5510196
NCBI-ProteinID: XP_001630650
JGI: 113343
UniProt: A7SCJ3
LinkDB All DBs
AA seq 645 aa AA seqDB search
ATCSRNFHFKVEGRQGPDKTSKTELAREYPVVDHTYDAVVVGAGGAGLRAAFGLSQEGFK
TACITKLFPTRSHTVAAQGGINAALGNMEPDDWRWHMYDTVKGSDWLGDQDAIHYMTEEA
PKAVIELENYGMPFSRTEEGKIYQRAFGGQSYDYGKGGQAHRCCAVADRTGHSLLHTLYG
QSLRYDCEYFVEYFALDLLMDKGKCVGVIALCLEDGSLHRFRAKNTVLATGGYGRAYFSC
TSAHTCTGDGTAMVTRAGLPNEDMEFVQFHPTGIYGAGCLITEGSRGEGGYLINSEGERF
MERYAPTAKDLASRDVVSRSMTIEIREGRGVGPMKDHVYLQLSHLPAETLKTRLPGISET
AMIFAGVDVTRDPIPVLPTVHYNMGGVPTNFKGQVGHLSFISGVSLSFRDEIVDGLWAAG
ESACASVHGANRLGANSLLDLVVFGRACANFIAKENKPGETLPDLPPSAGEASVANLDAV
RYANGSTPTAELRTDMQRTMQNHAAVFRTGPVLEEGCKKMDELYQKLKDLKLYDRSMVWN
SDLVESLELQNLMLNALMTIKSAEARKESRGAHAREDYKDRIDEFDYSKPLDGQIKKPFD
KHWRKHTLAWVDETTGKTTLDYRGVIDETLDQKDCKTVPPAVRSY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
gcgacatgtagtaggaattttcacttcaaagttgagggcagacaagggccagacaaaact
tcaaaaacagagcttgcacgtgagtaccctgtagttgaccacacctacgatgcagtggtt
gtgggtgcagggggagctggcctgcgcgcagcgtttggactgtcacaggaaggcttcaaa
acagcatgcatcaccaagctcttccccacgagatcacacacagttgctgcacagggagga
atcaatgcagcattaggaaatatggaacctgatgactggagatggcacatgtatgacacc
gtcaagggcagtgattggttgggggaccaagatgctattcactacatgacggaggaggca
cctaaagctgttattgagcttgagaactatggaatgcccttcagcagaacagaggaaggc
aaaatctaccagagggcatttggtggacaaagctatgactatggcaagggggggcaggct
cacaggtgctgtgcagtcgccgaccgtacgggacactcactccttcacaccctttatgga
cagtctctgcggtatgactgtgagtactttgtggaatactttgccctggatcttctcatg
gacaagggcaagtgtgttggtgtcattgccctatgcctggaagatggttctctgcaccga
ttcagagccaagaacactgtcctagccactggtgggtatgggcgtgcctacttctcctgc
acctctgcacatacgtgcactggtgacggcactgctatggtgacgagggcaggccttccc
aatgaggacatggagtttgttcagttccatccaacaggtatctatggtgctggttgcctg
atcacggagggctcacgtggtgagggggggtaccttatcaatagtgagggtgagcgattc
atggagagatatgcccccactgccaaagatcttgcctccagggatgttgtctctcgctcc
atgaccatcgagatccgtgaagggcgtggcgttggcccaatgaaggaccatgtctaccta
cagctttcacatcttcctgctgaaactctgaagacacgtcttcctggtatctcagagacg
gccatgatctttgctggtgttgatgtcacgagggatcctatccctgtgctgcccactgtt
cattacaacatgggtggcgttcctacgaacttcaagggacaggtgggtcacctttctttc
atttcaggggtttcattgagtttcagggatgagatagttgatggattatgggcggcaggg
gagtcagcttgtgcatccgttcatggtgcaaacagactgggtgctaactctctcctggat
ctggttgtgtttggtcgcgcatgcgctaacttcatcgccaaggagaacaaaccaggagag
acccttcccgacctgccaccaagcgctggtgaagcgtctgtagcaaatcttgatgcagtt
cgttatgcaaatggtagcacacccacagcagagctaaggacagacatgcagaggaccatg
cagaaccatgcagcagtgttccgtactggccctgtgctcgaagagggatgcaagaagatg
gatgagctctatcagaaactcaaagatctgaagctatatgatcgcagcatggtgtggaac
tcggacttggtggagtctcttgagctgcagaatctcatgctgaacgccttgatgacgatt
aagagcgctgaggcacgcaaggagagcaggggtgcacacgccagagaggactacaaggac
cgcattgatgagttcgactactccaagccactggatgggcagataaagaaaccgtttgat
aagcactggagaaagcacaccttggcctgggtggatgaaaccactggaaagacaacactg
gactacagaggcgtgattgacgagactttggaccagaaggactgcaagaccgttcccccg
gccgtgcgctcttactag

DBGET integrated database retrieval system