KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g165897Help
Entry
NEMVE_v1g165897   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00052  Galactose metabolism
nve00500  Starch and sucrose metabolism
nve01100  Metabolic pathways
nve04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NEMVE_v1g165897
   00500 Starch and sucrose metabolism
    NEMVE_v1g165897
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    NEMVE_v1g165897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nve04147]
    NEMVE_v1g165897
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NEMVE_v1g165897
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g165897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 5513664
NCBI-ProteinID: XP_001633874
JGI: 165897
UniProt: A7S392
LinkDB All DBs
AA seq 796 aa AA seqDB search
MDERLRFDCFPEAGATEELCQARGCCWVPAENRPPRPEPTSKPTGVNAPLDIPYCFYPLN
YGYSLTSKVATKTGYKKTLCPTKLPIKHQTSERKIKMTNLFKLHGDIYDPANKRYEVPIP
TPMITQKSNSQDYDVSFTSFPFGISVTRKSTGTVLFNSTVGGMIFEDQFLQISSLLPSSN
IYGLGEHADAFKLNVTWRRDTMFARDVATPEGMQYNLYGVHPFYLNVENDGNANGLFLLN
SNALEVILQPTPAITYRSLGGVLDFYMFLGPTPEAVAQQYITLIGKPRLPPYWGLGYHLC
RWGYGNVSRTITVNDNMRRYKIPQDVQWNDIEYMKDHLDFTVDSTNWGGLGDFVKKLHTQ
YDQHYIPIVDPGISNTQPSGSYPPYSDGLAMGVFVNASNGGPIVGQVWPGNTVYPDFFNP
STQSYWTKQISQFHDVVPFDGLWIDMNEPSNFVQGSTSGCPNTKWDNPPYTPHIIGDKLI
DKTLCMSARHYGYRHYDVHSLYGYTETVATMSALESIRGKRSMVISRSTFPNSGQHGGHW
LGDNQATWESMYLSVPGILNMNMFGIPLVGADICGFLGNTNYELCARWTQLGAFYPFSRN
HNTKGATPQDPASFGDKFASMARGVLLTRYRMLPYLYTLFFDAYNMGSTVARPLFFEFPK
DAKTLAIDRQFMWGSSLLVTPVLQQGASDVTGYFPDATWYNVYDVRLRAPCAPPGSELQR
EGSGGQYHKLGCPVLCDTPLHIRGGSIIATQKPDITTAASRKNPFELIVAKTGKDGEPAN
GRLFLDDGESLGTCNI
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaagacttcgttttgactgttttcccgaggccggtgctacagaagaattgtgt
caggcgcgaggctgttgttgggttcctgcagaaaacagaccaccgagaccagaacctact
tccaaaccaactggtgttaatgcacctttagatattccctactgtttctaccccctgaac
tacggatactcgctgacttcgaaagtcgcgaccaaaaccggctacaagaaaaccctgtgc
ccaacaaagctacctataaaacatcaaacttcagagcggaaaatcaaaatgacaaacttg
tttaaattgcacggtgatatatacgacccagccaacaagcgttatgaagttcccatccca
acaccgatgatcacacaaaagagcaacagccaggactatgatgtcagctttacctcgttc
ccatttggtatctctgttactaggaaatctactgggactgtcctgttcaatagcactgtt
ggaggcatgatatttgaagatcagttcctgcagatctcatctcttcttccttcctctaac
atctatggacttggagaacatgcggatgccttcaagcttaatgtcacctggagaagggat
accatgtttgcaagagatgtggcgaccccagagggcatgcagtacaacttgtatggagtt
catcccttctatttaaatgtagagaatgatgggaatgcaaatgggctattccttctaaac
agtaatgcattagaggtcatcttacagccaactccagcaatcacctaccggtcacttggg
ggagtgttggatttttatatgttccttggaccaactccagaggctgtcgcccaacaatat
atcacactgataggcaagcccagactgcccccttactggggtttggggtatcatctatgc
cgctgggggtatggtaacgtaagccgcaccattacagttaatgacaatatgcgacgctac
aaaatacctcaagatgtacaatggaacgatattgagtacatgaaagatcatctggacttt
accgtggacagtactaactggggaggcctgggggactttgtcaagaagcttcatactcag
tatgatcagcattacatccctatagtggatcctggtatcagcaacacgcagccgagcgga
tcctaccctccttacagcgacgggctagctatgggtgtctttgtgaacgcgtccaacggt
ggtccgatcgtaggacaggtgtggcctggaaatacagtctaccctgatttcttcaacccc
tccacgcaatcttactggaccaaacaaatctcgcaattccacgatgttgtcccgtttgac
gggctgtggattgacatgaacgagccgtccaacttcgtgcaaggctcgacgtcaggctgt
cccaacacaaaatgggataaccccccgtacaccccgcacatcatcggcgataagctgatc
gacaagacgctttgtatgtccgcaaggcactacgggtatcggcactatgacgtgcacagt
ctctatggttacaccgagaccgtcgctaccatgagtgcccttgagagcattcgaggaaaa
cgttctatggtcatcagtcgctcaacgttccctaacagcggacaacatggcggccactgg
ctaggagacaaccaggccacgtgggaaagcatgtacctctctgtgccaggtatcttgaat
atgaacatgtttgggatccctctggttggagctgacatctgtgggtttttgggcaacacc
aactacgagctatgtgcacgctggacgcaacttggtgcattttaccctttctctcgcaac
cacaatactaaaggcgcaactccacaagacccagcgtcgtttggtgacaaattcgccagt
atggcaaggggcgtccttttgacgagatatcgcatgctcccctacctttacacgctgttc
ttcgatgcatacaacatgggttcgaccgtcgcaaggccgctcttttttgaattccctaag
gacgctaagacgcttgccatcgaccgccaattcatgtggggttcgtccctcctcgtcaca
cccgttctgcagcagggtgcctctgatgtgacggggtatttccctgacgccacgtggtac
aatgtttacgacgtaaggttgcgtgcaccctgcgcaccccctggaagcgagctacagcgt
gaaggtagtggcggtcaatatcacaagcttggatgccccgtgctctgcgacacacctcta
catatccgcggagggtcaatcatagccacccagaaacctgacatcactactgccgctagt
cgtaaaaacccgttcgaactcatagtagcgaaaactgggaaagatggcgagcccgcgaat
ggacgactgttccttgatgatggagaatccctaggtacgtgtaacatttga

DBGET integrated database retrieval system