KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g167821Help
Entry
NEMVE_v1g167821   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00052  Galactose metabolism
nve00511  Other glycan degradation
nve00531  Glycosaminoglycan degradation
nve00600  Sphingolipid metabolism
nve00604  Glycosphingolipid biosynthesis - ganglio series
nve01100  Metabolic pathways
nve04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NEMVE_v1g167821
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    NEMVE_v1g167821
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    NEMVE_v1g167821
   00604 Glycosphingolipid biosynthesis - ganglio series
    NEMVE_v1g167821
   00511 Other glycan degradation
    NEMVE_v1g167821
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    NEMVE_v1g167821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nve04147]
    NEMVE_v1g167821
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     NEMVE_v1g167821
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g167821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 5511591
NCBI-ProteinID: XP_001631933
JGI: 167821
UniProt: A7S8R3
LinkDB All DBs
AA seq 652 aa AA seqDB search
MAVSYLLLAVSIVFSYINPIAAKSFTIDFDNNRFLKDGQPFRYISGGIHYFRVPQFFWKD
RLLKMKAAGMNAIQTYVPWNLHEPTPGKYNFDGGADLLSFLELAHSLDLVAIVRAGPYIC
AEWDFGGLPAWLLKNSSITLRSSKDQAYMSAVDSWMGVLLPKLKAYLYEHGGPVIMVQVE
NEYGNYYTCDHEYMNHLEITFRQHLGSNVILFTTDPPIPYNLKCGTLLSLFTTIDFGPGI
DPAAAFNIQRQFQPKGPFVNSEYYTGWLDHWGEQHQTKTSESVSQYLDKILALNASVNLY
MFEGGTNFGFWNGANANAGASSFQPVPTSYDYDAPLTEAGDPTEKYFAIREVVGKHASLP
DIPIPPATPKYSYGTVEMKRGARMIDILSELTPGGPYKSKYPQTMEELDQYSGFVLYRSQ
IPSMFTQSTRMLNVEGLVRDRAIVYVGSIRQRTLNRTKGESNATIVISEFLELDILVENM
GHIGYGSEMVDPKGLVGNVTIDNVQILNWEMYPLNLDNAVKNHKMQSLLASALPGTDNAI
SPTFYTGVIPAAPFGDTGFDCYLRLDGWSKGVVFINGFNLGRYWPVVGPQKTLYVPASVL
SADQKQSSLVILELDDSPCDYPETCLVSFVTDPVVNGTTSPIFRPPFKDTIP
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttcctaccttttgctcgcagtttccatcgtattctcgtacataaatccaatc
gctgcgaaatcattcaccatcgactttgacaacaataggttcttgaaggatggtcaaccg
tttcgctacatttctggaggaattcactattttcgggtgccacagttcttctggaaagac
agacttttgaaaatgaaggctgcaggaatgaacgcaatccaaacctatgtgccttggaat
ttgcacgagccaacaccgggaaaatacaacttcgatggtggtgcagatctgctctctttt
ttagagttagctcacagtctggacttggtggcgattgtccgagctgggccctatatttgc
gcggaatgggactttggaggcctaccagcctggcttttaaaaaactcttcaatcactcta
agatcgtccaaggaccaagcttatatgtcagctgtggattcatggatgggggtactattg
ccgaaactgaaggcttatttgtatgaacacggtggcccagttattatggtccaggttgaa
aacgagtatggtaattactatacatgtgatcacgaatatatgaaccatttagaaatcaca
ttcagacagcacttggggagtaatgtaatcctattcacaactgaccctccgatcccatat
aatctcaaatgtggaactctgctgtccctttttactactatagactttggtccaggtatt
gacccagccgcagcatttaacatacagcggcagtttcagcctaagggcccattcgttaat
tcagagtattacactggctggctagaccactggggtgaacagcatcaaacaaagacttca
gaatctgtgtctcagtaccttgacaaaatcctggctttgaatgcatctgtgaatctctat
atgtttgaaggaggtaccaattttggattttggaatggtgcaaatgctaatgctggtgct
agtagctttcagcctgttccaacaagttatgattatgatgcaccactgacggaggctgga
gaccccacagagaagtactttgccataagggaggtggttggaaaacatgcctcacttcct
gacattcccattcctccagccacacccaagtattcttatggaacagtggaaatgaaaaga
ggtgcgcgcatgattgatatcctgtcagagttgaccccgggtggtccatacaagtcaaaa
taccctcaaacgatggaagaacttgaccaatacagtggttttgtcttgtaccgtagtcag
attccttccatgtttacacagtctacaaggatgctgaatgttgaaggacttgtccgtgac
agggctattgtatacgtgggtagcatcagacaaaggaccctcaaccgtacaaaaggagag
tccaatgccacaattgtcatatccgaatttctggaacttgatatcttggtagagaatatg
ggacatattggttatggctctgaaatggttgaccccaaaggacttgttggaaatgtcaca
attgataatgttcagattctgaattgggaaatgtatccactaaatcttgataatgctgtt
aagaaccataaaatgcaatccttattggcaagtgctctccctggaactgacaatgctatc
tcaccaacattctacactggagtgatccccgctgccccatttggtgatactggatttgat
tgctacttgcgattagatggctggagtaaaggcgttgtcttcattaatgggttcaacttg
ggccggtactggccagtcgtagggccccagaagaccttgtatgtcccagccagtgtattg
tctgccgaccaaaagcagagttcgctagtgatccttgaacttgatgattccccatgtgat
tatcctgaaacttgtctcgtaagttttgtcacagacccagttgtaaatggcaccacaagc
cctatatttaggcctccctttaaagacaccatcccttaa

DBGET integrated database retrieval system