KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g170524Help
Entry
NEMVE_v1g170524   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    NEMVE_v1g170524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nve01002]
    NEMVE_v1g170524
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nve04147]
    NEMVE_v1g170524
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     NEMVE_v1g170524
Peptidases [BR:nve01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   NEMVE_v1g170524
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEMVE_v1g170524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 MAM DUF1986
Motif
Other DBs
NCBI-GeneID: 5508550
NCBI-ProteinID: XP_001629146
JGI: 170524
UniProt: A7SGX2
LinkDB All DBs
AA seq 299 aa AA seqDB search
MWHEANVRITQGGIHTLMFEGIVGYSYQGDIAIDDVTIKSCATRPPFPTTQAPVASCGVR
PSTRIVGGTAAKQGDWPWQAQLRSTSGFPFCGGSLIHPQWVLTATHCVSSRRPTDLNIRL
GAHNRRANLGMEQDIKVEKIIMHPGYRKPVGLAHDIALIKLLKPANLNRHVNLVCLPDAV
PAPTDGTRCWITGWGRLASGGTAPDILQQASVPVVSRARCEKAYPGKIHDSMLCAGLDQG
GIDTCQGDSGGPMVCESRGRFYIHGATSWGYGCAQPGKFGVYAHVKNLVAWVRSEMARN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacgaggcgaacgtcaggattacacagggcgggatacacacgctgatgtttgag
ggtatcgttggttatagttaccaaggagatatcgctattgatgacgtcactatcaagtca
tgtgcgacacgtccaccattccctacaactcaggcaccagttgcctcgtgtggcgttcgt
ccgagcacgcgcatcgtggggggaaccgctgccaaacagggcgattggccatggcaggct
cagcttagaagcacctcagggttcccgttttgcggaggctctctgattcatcctcaatgg
gttttgacggcgacacactgcgtgtctagtaggagacccacggatcttaacatcaggctt
ggcgctcataatagacgagcaaacctcgggatggagcaagacattaaagttgaaaaaatc
atcatgcacccaggatatcgaaaacctgtaggacttgcgcacgacattgcactcatcaaa
ctgctcaagccggctaacttaaacagacatgttaacctggtgtgcctgcccgatgctgtc
cccgcgcctactgatggtactcgctgctggatcacggggtggggtcgcctggcgtccggt
ggtacagccccggacatcctccagcaagcctcggtccctgtggtgagccgggctcgttgt
gagaaggcttaccctggtaagatccacgactcaatgctctgcgcaggtctcgaccagggt
ggaatagacacctgccagggagattctggcgggccgatggtgtgtgagagtcgggggcgg
ttctacatccacggagcaaccagctggggatatggctgcgctcagccgggcaaatttggc
gtctatgcgcatgtcaagaatctagtcgcgtgggtcaggtctgagatggccaggaattaa

DBGET integrated database retrieval system