KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g179476Help
Entry
NEMVE_v1g179476   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00010  Glycolysis / Gluconeogenesis
nve00053  Ascorbate and aldarate metabolism
nve00071  Fatty acid degradation
nve00280  Valine, leucine and isoleucine degradation
nve00310  Lysine degradation
nve00330  Arginine and proline metabolism
nve00340  Histidine metabolism
nve00380  Tryptophan metabolism
nve00410  beta-Alanine metabolism
nve00561  Glycerolipid metabolism
nve00620  Pyruvate metabolism
nve01100  Metabolic pathways
Module
nve_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NEMVE_v1g179476
   00053 Ascorbate and aldarate metabolism
    NEMVE_v1g179476
   00620 Pyruvate metabolism
    NEMVE_v1g179476
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NEMVE_v1g179476
   00561 Glycerolipid metabolism
    NEMVE_v1g179476
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NEMVE_v1g179476
   00310 Lysine degradation
    NEMVE_v1g179476
   00330 Arginine and proline metabolism
    NEMVE_v1g179476
   00340 Histidine metabolism
    NEMVE_v1g179476
   00380 Tryptophan metabolism
    NEMVE_v1g179476
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEMVE_v1g179476
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     NEMVE_v1g179476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 5519935
NCBI-ProteinID: XP_001639716
JGI: 179476
UniProt: A7RLS5
LinkDB All DBs
AA seq 523 aa AA seqDB search
MALRIAASIPRVLLRRSIPAVSKLRGFAQAQAAVDDNPEIKYNQVFINNQFVNSVSGKTF
QTFNPSTGEVICDVAEGDKHDVDIAVKAAQSAFKLGSPWRTMDASDRGRLLNRLADLIER
DKAYLASLETLDNGKPYNDSFNVDLEFTIKCYRYYAGWADKIHGKTIPLDGSFFCYTRHE
PVGVVGQVIPWNFPLLMQAWKLGPALACGNTVVMKPAEQTPLTALYVASLIAEAGFPEGV
VNIVPGFGPTAGGAIASHMDVDKIAFTGSTEVGHIIQQSAGASNLKNVTLELGGKSPNIV
LADSDVDFAVDMSHFALFFNQGQCCCAGSRTFVQEGIYDEFVEKSVQRAKNRVVGNPFDL
KTQQGPQVDGEQMTKILNLIESGRKEGAKLEVGGDRAGDKGYFIQPTVFSDVQDNMRIAQ
EEIFGPVMQIFRFKDMNDIIERANKTTYGLAGSVMTKNLENALMLSNSLRVGTVWVNCYD
ALSAQAPFGGYKMSGVGRELGEYGLQQYSEVKTVTIAIPQKNT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcgcatcgctgcctcgattccgcgagttctcttgaggaggtccattccagct
gtatctaagctaagaggctttgcccaagctcaggctgcagtagatgacaaccctgaaatc
aagtacaaccaggtgttcattaacaaccagtttgtaaactctgtgagtggcaagaccttc
caaacattcaacccatcgactggagaggtcatctgtgatgttgcagagggagacaagcat
gatgttgatatagcagtgaaggctgctcagtctgcatttaagcttggttctccctggcgc
acaatggatgcatctgaccgaggcaggctgctcaacagactcgcagatctgattgagaga
gacaaggcttatctggcgagtcttgagactctggataatggcaagccatataacgactcg
tttaatgtggacttggagttcaccatcaagtgttatcggtactatgccggctgggcagac
aagatccacggcaagacaattccccttgatggctcgttcttctgctacacacgacacgag
cctgtgggagtggtgggtcaggtcatcccttggaatttcccactcctgatgcaggcatgg
aagcttggccctgctcttgcctgtggtaacacggtggtgatgaaaccagcagagcagaca
ccgctgaccgccctgtatgtggcttcactcatcgctgaggctggattccccgagggtgtg
gtcaatatcgtacctggcttcggcccaactgctgggggtgccatcgcgagccacatggac
gtggataagatcgcattcactggatccacagaggttggtcacatcatccagcaatcagca
ggggctagtaacttgaagaatgtgacgcttgagctgggaggcaaaagccccaacatcgtg
ctggcagactcagatgtggactttgctgtcgatatgagccatttcgctctcttctttaac
caaggccagtgttgctgtgcgggtagcaggaccttcgtgcaggagggaatctatgatgag
ttcgtggagaaaagtgttcagagggccaagaacagagtcgtggggaacccctttgacctt
aaaactcagcagggaccacaggtcgatggagaacagatgactaagatcctcaatctaatt
gagtctggtcgtaaggaaggtgccaagctggaggttggaggagatcgtgcaggagataag
ggctacttcatccagcctacagtattttctgatgtccaggataacatgcgcattgcccag
gaagagatctttggtccagtgatgcagattttccgattcaaggacatgaatgacattatc
gagcgagcaaacaagacaacttatggtcttgcgggatctgtcatgacaaagaacctggag
aatgccctgatgctgtccaatagcctccgtgtcggcactgtatgggtgaactgctatgat
gcgctatcagcccaggctcctttcgggggatacaaaatgtctggtgttggtcgtgaactg
ggtgaatatggattgcagcagtactctgaagtgaaaacggtcaccatagcaatcccacaa
aaaaatacttga

DBGET integrated database retrieval system