KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g183554Help
Entry
NEMVE_v1g183554   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nve04121]
    NEMVE_v1g183554
Enzymes [BR:nve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     NEMVE_v1g183554
Ubiquitin system [BR:nve04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    NEMVE_v1g183554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E3_UbLigase_R4 UPF0547 DZR
Motif
Other DBs
NCBI-GeneID: 5515332
NCBI-ProteinID: XP_001635492
JGI: 183554
UniProt: A7RYW5
LinkDB All DBs
AA seq 2201 aa AA seqDB search
MGELREIGGVRAIPYMQVLLMLCSDLEDNEPDRSALDCVITKCLAELELDKKNYQKMSER
NDQHEVQLIIMRFLSVLMSRTKSSSRTSSEAPSIVCCRTATRLGEVSIVEHCLELLKCLL
TYWKALAKKEEASHCSRLLGRMARIGKCFPSNPPPDMSPFFLRQYVKGHAGDVFEAYPQL
LTEMILRLPYQVKKVADSIDDFVAPQFTDEWMENLCEYMMVQQTPFVKRQVRKLLMFLCG
SKDNYRQLRDLHALDYHMRGVRNLSCDGGFDPDQANNLPVVLSYDALITLIEHLKACSEV
ASSRISNWQAYCIQEKSGLSFLLRASYLFEEGVAPLILQLLSYAICGAKAVVAGSSPTKP
RKDKDKDKDKETEKDKGMKPPPKKNDKSINVITSKLVQQLQEFVDMGIMCQFVRSFLLES
NSTAMRWQAHELLCKIHKHSTPSQQDKLSDMMWKIWPELPGYGRRAAQFVDLLGYFTIKS
AAKTDKFNSYCEKAVQLLKTQNTILGNHPNSNVYRMLSGFVEFDGYYLESDPCLVCNNPE
VAFQSLKLSSIKADSRFTTTSQLVKLTGNHTISRITLRVADLKRQKMVHTINLYYNNRTV
QSVVELKNKRPLWHKAKKCHLTPGQTELKVDFPLPIIACNLMIEYADFYENFQASSETLQ
CPRCSASVPANPGVCSNCGENVYQCHKCRSINYDERDPFLCNACGFCKYAKFDYTLTARP
CCAVDPIDNEDDRKKAVASINSLLERADRVYRQLVAHRQPLDLLLTRIMEHGDAEGSSVA
GVPAATYASAVQTGTTSSSTVNKSIQALAHRYCVECKTNFDDLSKITQKVLASRKELLEY
DCRIREGTIDSSQGSTRDRTSHPSMLNHALPRSLSMLQSGKVVPGTCYGCAAAATEHCVT
LLRALAMIPATRERLVEEGLIQELVDFNLHQGTAQMRGDVRHLLCLLTKNNVGATEKLDH
ILEQRVTDALAGQRSNPAMVSGIGREMLLLSNTIEMEDQCWEQRLRCVMRVFMMSVEAHS
PLVMESITLPCLKILLRLVKPPAPTSKKNKVMYWDSLGTIKGIGEIRTQAKRWLSEVPGH
SYKDWKQQALQRPQRPMGPQVVGKESRDEARKRYLMEKFVRKWKKRTKRQSPSEADIPEE
GWLRQALFTPSSRAARQIACTIVESLCQGPNRRKHMLDLLTSFLDEVGSAGENASEYFQL
YQRLIQPSYWKFYLSLQGALLQIGQLITQEIERLSYLEQNTLSSDLSQGYALKMLTELLA
SFIEHDSIKQKFKGKLVGTVLNGYLSLRRLIVQRTKLIDETQELLLELLEEMTTGTEVET
RAFMAICVETLNRYGLDDLRTPVFIFERLCNLIYPEENDIGEFFMSLEKDPQQEDFLQGR
MQGNPYSSNEPGLGPLMRDVKNKICTDCELVALLEDDSGMELLVNNKIISLDHPVKDVYK
KIWCPEGEGEPMRIVYRMRGLLGDATEEFVESLDDNNEEDVDNEEVYKMASVMSVCGGLE
AMLTRLSGIRDLSRGKQLVQVILKLLSYCVKLKVNLKYLCNPSLNALNVLLGTLNQALQM
EQESSGVGGAIIAEEVLRIMETILQEATSSAEPTRTQTQQDSSQLDTLLDRITSPFVRSN
TNVLQAMMRIIPFLTFGDEKNMKTLIVHFLPYLDFNKFDVERSTDETLFIDCFCNIAGGI
ENNHSGLRLKEMIITNSIVEKAIKYLHTYTPQKPISKANLSEVDAWKEFLARPSLPYVLR
LLSGLCRGDPHTQSIVGETSIPVIHRLEQVSSEEMVGSLAENLLEALRESPQVGKKVNEV
RRQTRTEKKRLAMAMREKQLGALGMQTMSGGKIVAKPSSLMREMEDLSEETGLVCCICRE
GYKYHPQKVLGIYTFTKRCILEDFENKQRKTQGYSTVSHFNVVHYDCHMAAVRLARGRDE
WESAALQNANTKCNGLMPIWGPLVSESAFASCLARHNSYIQECTGHMEPTYYMAVHDLRL
LFTRFAFERSFSDDTGGGGRQSNVHFIPYAVHMILYVLNTTRQRSREEKTLKAFLEASPE
KFVESCYEVDSPFYHTLLSLFVYSYDQWQEHRMAFYRRLLATVHIRHSTPAGSSKVSDTS
VLPYTVYRPAVIYFFFLDQLQSIFKKNLVISSGTSWPQAMAENIRNNDETILKSCDKILT
SYQEDLLPAESFMELCDVAGVLDQLDNVDTFLSDIISGLPQ
NT seq 6606 nt NT seq  +upstreamnt  +downstreamnt
atgggagagctaagagagattggaggggttagggccattccatatatgcaggtactgcta
atgctgtgttctgatcttgaggacaatgagccggacagatctgctctagactgtgtcatc
accaagtgtctggcagagctggagcttgacaaaaagaattaccagaagatgtcggagagg
aatgatcagcatgaggtccagctgattatcatgcgtttcttaagtgttctcatgtccagg
acaaagtcatcaagcagaacatctagtgaggcgccgtccatcgtgtgctgtagaactgct
accagactgggtgaagtgagcatcgttgagcactgtctggagttactcaagtgtttgttg
acctactggaaggcactagcaaagaaagaggaggcaagtcattgcagtagattgctaggg
cgcatggccaggattggaaaatgttttccttccaatcctcccccagacatgtcaccattt
ttccttaggcagtacgtcaagggtcatgccggggatgtgtttgaggcctatccacagttg
ctgactgagatgatactgagacttccttaccaggtcaagaaggttgcagactctattgac
gattttgttgctccacaattcacagacgagtggatggagaatctttgtgaatacatgatg
gttcagcaaacaccctttgtgaagcgccaagtgagaaagttgctgatgttcctctgtggc
tcaaaagacaactaccgccagctcagagatctgcatgcactagactatcacatgcgagga
gttaggaatctgagttgtgatggtggctttgaccctgaccaagccaacaacctgcctgtt
gtgttgtcctatgatgcgcttatcacactgatcgagcatctcaaagcctgttccgaggtg
gcatccagccgaatcagcaattggcaagcttactgcatacaagaaaagagcggcttgtcg
ttcctgttgcgcgctagttacctgtttgaagaaggcgtggctcccctgattcttcagctt
ctgtcttatgccatctgtggggctaaggctgttgtggctggctcctcgcccaccaagcca
cgcaaagacaaggacaaagacaaggataaagagactgaaaaagacaaaggtatgaagccc
ccccccaaaaaaaatgataaatcaataaatgtaataacgtcgaaacttgttcaacagctg
caagagtttgtggacatggggatcatgtgtcaatttgtgcgcagctttctgctagagtcc
aactctacggccatgcgatggcaggcacatgagcttctgtgcaagattcacaagcactcc
acgccaagccagcaagacaagctgtcagatatgatgtggaagatctggccagagttgcct
ggctatgggcgcagggcggcccagtttgtagatcttctcggttactttaccatcaagagt
gctgcaaagacagacaagttcaactcatactgcgaaaaggctgtgcaactactgaagact
cagaataccatccttggcaaccacccgaactccaacgtgtacaggatgttgtctggcttt
gtcgagtttgatggctactacctggagagtgatccatgtctagtatgcaacaaccctgag
gtcgcattccagagcctgaagctgtcgtccatcaaagcagattcccggttcaccaccacc
tcccaactcgtaaaactcactggcaatcacaccatctcacgcataacactgcgtgtggca
gacctcaaaagacagaaaatggttcataccatcaacttgtactacaacaaccgtactgtc
cagtctgtggtagagctgaaaaacaagagaccgctttggcacaaagcaaagaaatgtcac
ctgaccccagggcagacagaactcaaggttgactttcctcttccaatcatcgcttgtaac
ttaatgatcgagtacgctgacttctatgagaacttccaggcatcctcagagactcttcaa
tgtcctcggtgcagcgcgtctgtgcccgctaaccctggtgtgtgcagtaactgcggcgag
aacgtctaccagtgccacaagtgccgatctatcaattatgacgagcgtgacccgttcttg
tgtaatgcctgtggcttttgcaagtatgccaagtttgactacactctgactgctcgtccc
tgctgtgcggtggacccaatagacaacgaggacgacaggaaaaaggctgtagccagtatc
aactccctgttggagcgcgctgatcgcgtgtatcgccaactcgtggcccacaggcagccc
ctggacctgctactaacacgcataatggagcacggggacgctgagggtagtagtgtagct
ggggtaccggccgcgacgtacgcctctgctgtccaaacgggaaccacatcatcatccact
gtcaacaagtccatccaggcgctggctcaccgctactgtgtggagtgcaagacaaacttc
gacgatctcagcaagatcacgcagaaagtgctagcctctcgcaaagaactcctagagtat
gactgccgcattcgagagggtaccattgacagctcccagggttcaacccgcgacaggacc
tctcacccttccatgctgaaccacgcccttccccgcagcttgtccatgctgcagagtggt
aaggtggtgccgggaacctgttatggatgtgctgctgccgctactgaacactgcgtcacc
ctgctgcgagcactcgccatgatcccagccacaagggagaggcttgtggaggagggcctc
attcaagaacttgttgacttcaacctccatcaaggcacagcccagatgcgtggtgacgtc
aggcacttgctatgcctgctgaccaagaataacgtgggcgctactgagaaactagaccac
atccttgagcagagagtgacagatgcgttggcagggcaacgctccaaccccgcaatggtg
tctggtatcggccgagagatgctgttacttagcaacactatagagatggaggaccaatgt
tgggagcagcgtttgcgttgcgtcatgcgggtattcatgatgtcggttgaggcgcacagt
ccgctagtgatggaaagcatcaccctaccttgcctgaagatcctccttcgccttgtcaag
ccccctgcccctaccagcaagaagaacaaagtaatgtactgggatagccttggcaccatt
aaaggtattggcgagattcgtacccaggccaaacgctggctttctgaggtacccggccac
agctacaaggactggaaacagcaggcactgcaaaggccgcaaaggccgatgggaccccaa
gtagtgggcaaggagagcagggatgaagcaagaaaaaggtatctgatggagaagttcgtg
cgcaagtggaagaagcgcaccaagcgacagtcaccctcagaggcagacattcccgaggag
gggtggctgaggcaggctctgttcaccccatcaagccgtgcggcccggcaaatcgcgtgc
accatcgtggagtcgctttgccagggtcccaaccgccggaaacacatgctagacttgcta
acaagtttcctggacgaagttggctcagcgggtgagaatgcttcggagtacttccagttg
taccagcgtctcatccagcccagctactggaagttctacttgtcactgcaaggtgccttg
ctgcagataggacagctcatcactcaggagattgagcggttgtcataccttgagcagaac
acgctaagctcagatttgtcacagggatacgcactcaagatgctcacagaactgttggct
tcgtttatcgagcatgacagtattaagcagaagttcaagggcaaacttgtggggacggtg
ctgaatggctatctctccctgaggagattgattgtacagcgcaccaaactgattgatgag
acacaggagcttctgctcgagctactggaggagatgacaactggtacggaggtagagacg
cgtgcatttatggctatatgtgtggagacgttgaacagatatggcctggatgacttgcga
actcccgtgttcatctttgagaggctctgcaacctgatctatcctgaggagaatgacatt
ggtgaattcttcatgagtttggaaaaagacccccaacaagaggactttctacagggtcgg
atgcagggcaacccgtatagttctaacgagcctggcttggggcccttaatgcgagacgtg
aagaacaaaatttgcacagattgcgaattggtggcacttctggaagatgacagtggaatg
gagctgcttgtcaataacaagatcattagcttagatcaccctgtgaaggacgtgtacaag
aaaatctggtgcccagagggcgagggggaaccgatgcggattgtatacagaatgagaggt
ttacttggtgatgcaactgaggagtttgtggagagtctggatgacaacaatgaagaagac
gtggataacgaagaggtttacaagatggcgtccgtcatgtccgtctgcgggggactagaa
gccatgctcaccagactgagtggaatacgtgatctgtctcgtggaaaacaactagtgcaa
gtaattctgaagttgctgagctactgcgtcaaactgaaggtgaatctgaagtacttgtgc
aacccgtcactcaacgctttgaacgtgttactgggaacgctcaaccaggcgttacagatg
gagcaggaatctagcggagtaggcggcgccatcatcgcagaggaggtgctacgtatcatg
gagaccatcctgcaagaagcgaccagctcagccgaacccacccgcacccagactcaacag
gacagctcccagctcgacacgcttctcgacaggatcaccagtccatttgtgcgatcaaac
acaaacgtgcttcaagcaatgatgcgaattatcccattcctgacgttcggtgacgagaag
aacatgaagacacttatagttcacttccttccctacctggactttaacaagtttgatgtt
gagcgatccacggacgagaccctgtttatcgattgcttttgtaacatcgctggaggaata
gagaacaatcacagcggactgaggctgaaggaaatgatcatcacgaacagtatcgtggag
aaggccatcaaatacctgcacacttacactccacaaaagccaatcagcaaagcgaaccta
tccgaggtggatgcgtggaaagagttcctagcgcgcccctcgctaccttatgttctgcgt
cttctatctggtctgtgcagaggagatcctcatacacagtccattgtgggcgagacaagc
attcccgtcattcatcgtctggagcaagtgtcatctgaagagatggtgggatcccttgct
gaaaacctgcttgaagcattacgagaaagcccacaggttgggaaaaaggtgaatgaagtt
cgtcgtcaaacaaggacagagaagaaaaggctggcaatggcgatgagggagaaacagcta
ggggcgctaggcatgcagaccatgtctggaggtaagattgtcgccaaaccctctagcctc
atgcgtgagatggaagacctatcagaggagaccgggctcgtctgctgcatctgccgtgag
ggctacaagtaccaccctcagaaggtcctaggtatctacactttcacaaagcgatgcatc
ctggaggactttgagaacaagcaacggaaaacgcagggttattccactgttagtcacttc
aatgtcgtccactatgactgccacatggctgccgtcaggctggcccgtggtcgtgatgag
tgggagagtgcagcgctacagaatgccaacaccaaatgtaacggactcatgcctatctgg
ggccctctggtgtccgagtctgccttcgcaagctgcctagcaaggcacaatagctacatc
caagagtgcacaggtcacatggagcccacgtactacatggctgtccacgacctccgcttg
ctgttcactcgctttgcgttcgagagatccttcagtgacgatactggcggcggcgggcgt
cagagcaacgtgcactttataccgtacgcggtgcacatgatactctatgtcctgaatacg
accagacagagaagccgggaggagaaaaccctgaaagcgttcctggaagcatcacccgag
aaatttgttgagtcatgttatgaggtcgacagcccgttctaccacaccctgctgtcgctg
tttgtctactcgtacgaccagtggcaggagcatcgcatggcattctaccgaaggctactc
gctacagtccacatccgacacagcactcccgcgggatccagcaaggtgtcggacacgagt
gtccttccatacactgtctaccgacctgcggtgatctacttcttcttcctcgaccaactc
cagagcatcttcaagaaaaatctggtgatctcaagcggtacgagctggcctcaagcgatg
gcagagaacatccgcaacaatgacgaaacgattctgaaaagctgcgataagatcctgaca
tcctaccaggaggatctacttcccgcggaatccttcatggagctgtgtgacgtcgctggg
gttctagaccagctggacaacgtggacacattcctgtcggacataatctccggactgccg
cagtga

DBGET integrated database retrieval system