KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g188209Help
Entry
NEMVE_v1g188209   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve03030  DNA replication
nve03410  Base excision repair
nve03420  Nucleotide excision repair
nve03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NEMVE_v1g188209
   03410 Base excision repair
    NEMVE_v1g188209
   03420 Nucleotide excision repair
    NEMVE_v1g188209
   03430 Mismatch repair
    NEMVE_v1g188209
Enzymes [BR:nve01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NEMVE_v1g188209
    6.5.1.6  DNA ligase (ATP or NAD+)
     NEMVE_v1g188209
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NEMVE_v1g188209
DNA replication proteins [BR:nve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NEMVE_v1g188209
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NEMVE_v1g188209
DNA repair and recombination proteins [BR:nve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NEMVE_v1g188209
   NER (nucleotide excision repair)
    Other NER factors
     NEMVE_v1g188209
   MMR (mismatch exicision repair)
    Other MMR factors
     NEMVE_v1g188209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 5510104
NCBI-ProteinID: XP_001630571
JGI: 188209
UniProt: A7SCK7
LinkDB All DBs
AA seq 609 aa AA seqDB search
MSILSNFFRSVIALTPNDLLPCVYLCLNKLAPAYEGIELGIGDHILMKAVSEATGKILSQ
IKADLADKGDLGLVAEASRSNQRTMFAPPKLTAASVYSKLKDIALFTGHSSTGKKVDIIK
GMFVACRHSEARYLIRSLSGKLRIGLAEQSVLTALAHSVVLTPPSSEFPPPVIDAAKTLS
SDELKKMLDAGALTVKTCYCELPNYNKIIPALLEYGLEDLPNKCYLTPGVPLKPMLAHPS
KGVAEVLKRFEGSAFTCEYKYDGERAQIHLLENGEIHIYSRNQENNTSKYPDIISRMPKV
MSEEIKSFIIDTEAVAWDREKQQILPFQILSTRKRKDADVSEIKVQVCVYAFDLLYLNGK
SYVKEPFSVRRNLLRTSFKEAEGEFVFAKCMTSTNTEDMAEFLEESIKGNCEGLMVKTLD
VDATYEIAKRSHNWLKLKKDYLADVGDTLDLVPIGGYRGKGKRTGAYGGFLLACYDAESE
EFQTICKIGTGFTDEVLESHHQFFKDHVIDKPKPYYRYDDGLEPDHWFDAVQVWEVRAAD
LSVSPVHKAAVGQVDPVKGISLRFPRFLRVRDDKKPEEATDSTQVAEMYRDQDSVKNNAV
TTNQEEDFY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtccattctcagcaacttttttagatctgtgattgcattaacaccgaatgaccttctt
ccatgtgtctatctttgcttgaataagcttgccccagcatatgaaggaatagagcttggt
attggagatcacatcctcatgaaagccgtctctgaagctacaggtaaaattctctcccaa
atcaaagctgacttggcagacaaaggggatcttggtcttgttgctgaggctagtcggagc
aaccagcgtactatgtttgcgcctccaaaactcacagcagccagtgtttacagcaagctt
aaggacatagcattattcactggacatagttctacaggaaaaaaagtagacattattaaa
ggaatgtttgtggcgtgtcgtcactctgaagcaaggtacctcattcggtcacttagtggc
aagctcaggataggacttgcagaacagtcagtcctcactgcactggctcactctgtggta
cttacacctcctagttcagaatttcctccacctgtgattgatgcggctaagacgttgtct
agtgatgaacttaaaaagatgttagatgcaggcgcacttacagtcaagacatgttactgt
gaactaccaaactataacaagatcatacctgcacttctggagtatggacttgaggatctg
cccaataaatgctaccttacgccaggagtgcctttgaagcccatgttggcacacccctct
aagggtgtggccgaagtactcaaaaggtttgaaggcagtgccttcacatgtgaatacaag
tatgatggtgaacgtgctcagatacatcttctggaaaatggcgaaatccacatttatagt
agaaaccaggaaaacaacacatcaaaatatccagatatcatttcaaggatgcccaaggtc
atgtcagaggaaatcaagtccttcatcatcgacactgaagcagtagcttgggaccgagag
aagcaacaaattctgccattccagattcttagcacaaggaaaagaaaggatgcggatgtt
tccgagatcaaagtgcaagtttgtgtctacgccttcgatctactctacctcaatgggaag
tcttatgtgaaggaacctttcagtgtcaggaggaaccttctgagaacatctttcaaggaa
gctgaaggggaattcgtgttcgctaaatgcatgacttcaacaaacacggaagacatggca
gagttcttggaagagtcgattaaaggtaattgcgaggggttgatggttaagactttagac
gttgatgccacctacgaaatcgctaagaggtctcataactggcttaagttgaagaaagac
tatcttgctgacgtcggcgacaccctcgacctagtccccatcggaggctatcgaggcaag
gggaaaaggactggggcctacggtggctttctgttggcttgttatgatgcggagagtgaa
gagtttcaaacaatttgcaagatcggaaccggcttcacggatgaagttctcgagagccac
catcagttcttcaaggatcacgtgatcgacaagcccaaaccgtattatcgctatgacgac
ggactggagcctgatcattggtttgacgccgtccaggtgtgggaggtgagggccgctgac
ctgtccgtctctcccgtccacaaagctgcggtcggacaagtggaccccgtcaagggcatc
tcgctgcggttcccgcgctttctgcgcgtgcgcgatgacaaaaagcctgaagaggcaaca
gacagcactcaggttgccgagatgtacagagatcaagacagtgtaaagaacaatgcagta
acaacaaatcaggaggaagatttctattaa

DBGET integrated database retrieval system