KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g193535Help
Entry
NEMVE_v1g193535   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00040  Pentose and glucuronate interconversions
nve00051  Fructose and mannose metabolism
nve01100  Metabolic pathways
Module
nve_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NEMVE_v1g193535
   00051 Fructose and mannose metabolism
    NEMVE_v1g193535
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     NEMVE_v1g193535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-GeneID: 5503967
NCBI-ProteinID: XP_001624910
JGI: 193535
UniProt: A7SU04
LinkDB All DBs
AA seq 316 aa AA seqDB search
MHTVGICGSDVHYWKHGCIGDFVLTAPMVLGHESSGVICAVGEGVSDLKEGDRVAIEPGT
PCRTCSYCKKGRYNLCAKMNFCATPPYHGSLCRRYNHQADFCYKLPDHVSLEEGALLEPL
SVGVHACNRAGITIGSNVLVCGAGPIGLVTLLTAKACGASKVAITDLDEGRLKKARELGA
DYTIKVESRDGRDMARKVQELLGPADQTVECTGAESSIHTGIYATKSGGVLVIVGMGKSK
ITLPIVDALCREVDIRGIFRYVNCYPTALAMVASGRVNVKPLITHHFKLEESLQAFETSR
TGAGGAIKVLIHCNKE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcatacggtcggtatctgtggctcagatgtgcattactggaagcatggatgcattggg
gactttgtcctcactgcacccatggtcctgggtcatgagtcaagtggcgtcatctgtgct
gtcggagagggcgtgtctgatctcaaggagggtgaccgtgttgccattgagcctggtact
ccctgcaggacctgttcctattgtaagaaagggcgctataacctgtgtgccaagatgaat
ttctgtgccacccctccctaccatgggtcgttgtgtcgacgctataatcaccaggcagac
ttctgctataaactcccagaccatgtcagcctggaggaaggcgcattgcttgagccgttg
tccgttggtgtccatgcctgcaatagggcgggtataactattggcagtaatgttcttgtg
tgtggagccgggcctattggactggtgactcttctcacagcaaaagcttgtggagccagt
aaagttgcgatcacagatctggatgaaggccgactcaagaaagccagagagcttggagca
gactataccattaaggtggaaagcagggatggtcgcgatatggccaggaaagtccaggaa
ctccttggtcctgccgaccagacagtggaatgcacaggcgcagagtccagtatccacact
ggcatctatgctaccaagtctggtggtgtcctggtcattgtcggtatgggcaaatccaag
ataaccctgcctatcgtggacgccctgtgtagggaggttgacattcgtgggatattccgc
tatgtaaactgttaccccactgccttggcaatggtagcgtctggcagagtgaatgtcaaa
cccctcatcacacaccacttcaagttagaggaaagtctacaggcgtttgaaacaagcagg
acaggggctggcggcgccatcaaagtcttgatccactgcaacaaggaataa

DBGET integrated database retrieval system