KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g233903Help
Entry
NEMVE_v1g233903   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
Organism
nve  Nematostella vectensis (sea anemone)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A Nbs1_C
Motif
Other DBs
NCBI-GeneID: 5521973
NCBI-ProteinID: XP_001641735
JGI: 233903
UniProt: A7RFW4
LinkDB All DBs
AA seq 379 aa AA seqDB search
MYKLDLPVDMKETAAIERRRNRELQRQSRIFNARVRTIGIDLQALETQVADRKRQEVEEQ
RRHNAFAADMKRNDMICALMQQRQEHDIRELNKEVNTFRQEHQRPEDTREWELNDPDCLK
KDKPARVSDDDPRCGISSLQKFVGEDLNSKSRRKLQEEQMREWVKQQSNEKNQDKANQSY
ADYLYDLKARELDQRACELAQAESDCRRAINQATKDFNLALMKERQAKEDLEKQQELDDN
MTEISNHVFGDMLTENPDVAQSAFGGHRVITDRWKGMSPAQLAEIRYIQQQQLKEKERLK
QEEEEREKEYQRLLLTQAKAGILMERELERKRKQLEKDQAQENLRLSAEQKSHQEYVNKE
VYTNPPTAAYFMQFNTTSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtataagctagaccttccagtcgatatgaaggaaacggctgctattgagcgccggaga
aaccgtgaattgcagcggcaaagtaggattttcaacgcccgtgtcaggacgatcgggatt
gatctacaagccttggaaacacaagtagctgatagaaagcgccaggaagttgaagaacag
agaaggcataatgcttttgctgccgacatgaaaaggaatgacatgatttgtgcactaatg
cagcaacgacaggaacacgacatccgggagcttaataaggaggtgaacacattccgtcag
gagcaccagagacctgaagacaccagggagtgggaattgaatgatcctgactgtctcaaa
aaggacaagcctgcccgagtctcagatgacgacccacgctgcggtatctcatcattgcag
aagtttgttggtgaagacctgaactccaaaagtcgcaggaaactgcaggaggagcaaatg
agggaatgggtcaaacaacaatccaatgagaagaaccaagacaaagccaaccagtcatat
gctgattatttatatgacctgaaggcgcgcgagctggaccagcgagcatgtgaacttgca
caagctgaatcagactgccgtagagctatcaaccaggccaccaaagatttcaatcttgcc
ttgatgaaggagaggcaagcaaaggaggacttggaaaagcagcaggagcttgatgataac
atgactgaaatctcaaaccatgtatttggtgacatgttgacagagaatcctgatgtggct
caaagtgcatttggggggcatcgtgtgattactgatcgctggaagggaatgagtccggcc
caattggcagagatacgctatatccaacaacaacagcttaaagagaaagagagactgaag
caagaggaggaagaacgtgaaaaggagtaccagcggttgttgctaacacaagccaaggct
ggtatcttgatggagcgggaattggaacgcaagcgaaagcagcttgagaaagaccaggct
caagagaacctcagactctcagccgagcagaaatcacaccaagaatatgtcaacaaagag
gtgtacacaaatccacctactgctgcctacttcatgcaattcaacacaaccagcagatga

DBGET integrated database retrieval system