KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g237796Help
Entry
NEMVE_v1g237796   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
Organism
nve  Nematostella vectensis (sea anemone)
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 5522358
NCBI-ProteinID: XP_001642113
JGI: 237796
UniProt: A7RF74
LinkDB All DBs
AA seq 254 aa AA seqDB search
MTNALKRRVFSKGLASIQPFLGRSQQEMLLQKVEIVVGKTRKQSRVRMDELTRYHSYHLC
LYSKERNWMERPARTSVRRCLFGPVDHEQTKADLQREIKKVVESESRRWNFDFASETPQV
GRYAWFKRHESEALASNMDTACTTSLEQANRDILIEDTQQNEVQNSQRNVPRCELHTTTK
STDGTVARRKPKSRISTVRNLTKRPSTTPITDYLRQKKPKSKVVSTSKGMQLRTSNTRSS
IISKQTCLDKFFKN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgcgctaaaacgacgtgtttttagcaaaggattagcttccatacagccgttc
ttagggcgttctcaacaagagatgttgttgcaaaaagtcgaaattgtcgttggtaaaact
agaaaacagtcgagggtacggatggatgaactaacacgttatcactcgtaccacctgtgt
ctctatagcaaggagaggaactggatggaacgaccagctaggacttcggtacgtcgttgc
ttgtttgggcctgttgatcacgagcaaaccaaagcagacttgcaaagagaaatcaagaaa
gttgtggagtccgagtcaagacgatggaactttgacttcgctagtgagactccacaagtt
ggacgttatgcttggtttaaacgtcacgaaagcgaagcattagcctctaatatggataca
gcatgtactacaagcttagagcaagcaaacagggatattttaatcgaagatacacaacag
aatgaggtccaaaattcacaacgtaacgttccgaggtgcgagctacacacaacaacaaag
tcgaccgatggaacagtcgcgcgaagaaaaccgaaatctcgtatttctactgttagaaac
ctaacaaaacgcccttctactacacctattacagattatctgagacaaaaaaagccgaag
agtaaagtagtcagtacaagtaaaggaatgcaactacggacgagcaacacgagatcgtcg
atcatctccaaacaaacgtgtttggacaagtttttcaaaaattaa

DBGET integrated database retrieval system