KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g243223Help
Entry
NEMVE_v1g243223   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00330  Arginine and proline metabolism
nve00340  Histidine metabolism
nve00380  Tryptophan metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NEMVE_v1g243223
   00340 Histidine metabolism
    NEMVE_v1g243223
   00380 Tryptophan metabolism
    NEMVE_v1g243223
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     NEMVE_v1g243223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 DUF1965
Motif
Other DBs
NCBI-GeneID: 5512395
NCBI-ProteinID: XP_001632737
JGI: 243223
UniProt: A7S6L3
LinkDB All DBs
AA seq 794 aa AA seqDB search
MAKDYTTPSEHPASGGSKRWKLVSAGLLLLSLVFLIVIIVLGVKLNSKPAEASSGSVKET
KSCRRESPGIKLTRKSSGIFEDLRRDEIKRVRDYMLAQKTLDLTPYEKATVADNYIYFIK
LYLPNKADVLRYLDENGPKPERNAQVSLFMGKENKVREFIVGPVSSPSRHNEHRVPGQRY
PIPFNARPFDDIIELAAVQKLVHRVTSLLRALFLESYDGYTNDDCGEKCLTIIYSVPMGT
TSETRVNWFWFTRTVPGHYEFPIDFELYIQHEGSNVSNWNVEKIVYNDQKFDSAEDLLNA
YKSDSLNKSFFAAPIGESKDFASYKRRGKPKPQVPLRGPEQYQPDGQRYAVDDRRIEYMG
WEFEFGNDPSYGLAAYDIRFNGERVVYELSLQEAVATYGGYFPSQTSMNFLDASWRLGRS
SYELVRGVDCPGHATFFDLTNFIGTGEEETMRNAVCVFELNTGIPLRRHYDNDFAGSYKF
YGGMVNTALVMRTVSTVYNYDYIWDFIFYQNGVIEVKISASGYVMGSLYTDEVKNYAYKL
YKQLTSATHDHLLNIKVDLDVAGIKNSYETIEIGIENVTSKWEDNQRRVRKVLKRSTKST
EKDALYKFDFDHPKYLNFYSEKENRNGVKRGYRIQHAGIMKQLYPEDWMIVPMVSWSLYQ
LAVTRYNESERRSSSIYNQNSPTDTQVDFRNFVSDESIVNQDLVAWVTMGMIHVPHSEDL
PNTGTVGSSASFFIRPFNYFDEDPSIASSDAILITPSDKEASGQKIDRFGTPEGPVCVPA
EYSINFSGRYAKED
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggattacacgactccaagcgaacacccagcatcggggggatcaaagagatgg
aagcttgtttctgctggacttttattgctttccttggtttttctgatcgtgataatagtt
cttggggtcaaactcaattcaaagcccgcagaagcctcctcgggcagcgtaaaagagaca
aaaagctgccgacgcgaatctcctggaataaaacttacaagaaaatcgtctggaattttc
gaggatctgaggagagatgagatcaagagggtgcgggattacatgctagctcaaaagact
cttgaccttactccgtacgagaaagcaacagtggccgataactacatttacttcatcaag
ctttatttgcccaacaaagcggacgtgctacgctatcttgatgagaatgggcccaagccg
gagagaaacgctcaggtatcgctttttatgggtaaagaaaataaagtaagagaattcata
gtaggacctgtctcaagcccctcgcgacacaacgagcacagggtacccgggcagaggtac
cctatcccgtttaacgctcgaccatttgatgacatcattgagcttgccgcggtgcagaag
ctggtgcatagggtgacgtcattgttgcgcgcgctttttctcgagagctacgacggatac
accaatgatgattgtggtgagaagtgtttaacaataatatactccgtgcctatggggacg
acgagcgagaccagggttaattggttttggttcacccgaaccgtgccaggacactatgaa
ttcccgattgactttgagttgtatatacagcacgaaggctcaaatgtatcaaactggaac
gtcgagaagatcgtttacaatgaccagaagttcgattcagctgaagacctccttaacgca
tacaaaagtgacagtctcaataaatccttctttgcagctccgataggagaaagcaaagat
tttgcttcgtacaaaagacgaggcaagcccaaaccccaagtcccgttacgaggccccgaa
cagtaccagccagatggtcagcggtatgccgtggatgacaggcgcattgagtacatgggt
tgggagttcgagtttggaaatgacccctcgtatggtcttgccgcgtatgatatcaggttc
aacggagaaagagtcgtgtatgaattaagtctacaggaggcggttgcgacctatgggggg
tacttcccctcacagactagcatgaatttcctggatgcgagctggcgcttggggcgaagt
agttatgaattggtgcgtggtgttgactgccctggacacgcaaccttttttgacctgacg
aactttatcggtacaggagaagaggagacgatgcgtaacgcggtctgtgtgttcgagtta
aatacaggcattcctcttcgccgtcactatgacaacgatttcgcgggcagctacaagttc
tacggtgggatggtgaacactgccctggtcatgcgcactgtctccaccgtctacaactat
gactacatttgggatttcatcttctaccagaatggggtgatcgaggtgaaaatatcagca
tccggatacgtcatgggtagcctttatacggatgaggttaaaaactacgcttataaacta
tacaagcagttaaccagtgcaacacacgatcacctgctcaatatcaaagttgacctagat
gttgctgggataaaaaactcctacgagaccatcgagatcggcatcgaaaatgtcacaagc
aaatgggaggacaaccagcgtcgcgtgcgtaaagtcctcaaacgatccaccaagagtaca
gagaaagacgctctttacaagtttgatttcgaccacccgaagtatctcaacttctatagc
gagaaggaaaatagaaacggagtgaaaagaggctatcgcattcagcatgctgggataatg
aagcaattgtacccggaggattggatgatcgtaccgatggttagctggtctctttatcag
cttgcggttacgaggtacaatgaaagcgagagacgtagctcttccatctacaaccagaac
tcacccacagacactcaagtcgacttccgaaactttgtcagcgacgaaagcattgtcaat
caagacctggttgcctgggtaaccatgggcatgattcacgtgcctcattccgaagatctt
ccgaataccggcaccgtaggaagctcggctagtttcttcatccgaccgtttaactacttt
gacgaagacccatcgattgcttcttcagatgcaatcctcattacgccttcagacaaagaa
gccagcggtcagaaaattgacaggtttggaactcctgaaggccccgtatgtgtgcccgcg
gaatacagcataaatttcagcggtcgctatgccaaggaagactga

DBGET integrated database retrieval system