KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g243527Help
Entry
NEMVE_v1g243527   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00240  Pyrimidine metabolism
nve00983  Drug metabolism - other enzymes
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NEMVE_v1g243527
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    NEMVE_v1g243527
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     NEMVE_v1g243527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2 RecA
Motif
Other DBs
NCBI-GeneID: 5511757
NCBI-ProteinID: XP_001632136
JGI: 243527
UniProt: A7S8B0
LinkDB All DBs
AA seq 212 aa AA seqDB search
MALVTIPGLQHLHRHHSISECPGQIQVIFGPMFSGKTTELLRRIKRYQVANHKCLLIKYA
KDIRYDEEGVATHDRQILRATPCTVLEDLKNKAINHSVIGIDEGQFFPDIVEFSEEMASE
GKTIIIAALDGTFQRKAFGNILHLVPLAESVVKLSAVCMNCFKDASFTKRLGYDKRVEVI
GGADKYMSVCRECYNLAEVQELLSKHSKFQTH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggctctagtgacgattccaggtcttcaacatctacacaggcaccacagtataagcgaa
tgtcccgggcaaattcaggttatatttggaccgatgttctctggtaaaacgactgagctg
cttagaagaattaaacgctaccaagtagccaatcacaagtgtctactgatcaaatacgcc
aaagatatcagatatgatgaagaaggtgtcgccacacacgacagacaaattttaagggcc
accccatgcactgtcttagaggatttgaagaataaagcaataaatcattcagtcataggc
attgatgaagggcaattttttcctgatatagttgaattttctgaggaaatggccagtgaa
ggaaagacaataattatagctgctttggatgggacatttcaacgcaaggcttttggtaac
atcctacaccttgtgccactagccgagagtgttgtcaagcttagtgccgtctgcatgaat
tgcttcaaggatgcatcgtttacaaaaagactaggatatgataagagggtggaagttatt
ggtggcgctgataagtacatgtctgtatgtcgcgaatgctacaatttagccgaagtgcaa
gaactcctgtctaaacacagtaaattccaaactcattaa

DBGET integrated database retrieval system