KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g245849Help
Entry
NEMVE_v1g245849   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K17478  FK506-binding protein 15
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nve01009]
    NEMVE_v1g245849
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nve03110]
    NEMVE_v1g245849
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nve04812]
    NEMVE_v1g245849
Protein phosphatases and associated proteins [BR:nve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NEMVE_v1g245849
Chaperones and folding catalysts [BR:nve03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    NEMVE_v1g245849
Cytoskeleton proteins [BR:nve04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     NEMVE_v1g245849
  Microtubules
   Tubulin-binding proteins
     NEMVE_v1g245849
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 5507239
NCBI-ProteinID: XP_001627883
JGI: 245849
UniProt: A7SKD8
LinkDB All DBs
AA seq 692 aa AA seqDB search
MSSEATVLKTQLANAQTELQSLRKQEAEMRTVMNKATSESERFRVELESLKESLSESQLH
TEKLKQDLKEEKQTRKRVESRADHVEEEMADLQHEKDKLEKSVADRKKKHTQDRRKFEEE
LEELRAQHEDEIKSLKEKHRREKKNSGSVTTEEISKMESDLETRWTEKATKMVSQAVEKW
KRKYDDVIEERDEAARKLTTLEDKLSSLKSIEEKKNEEVNNLQEKIDELQNLQEKFTSAT
STGQEKDVEIERLKIAVQELEEAREKMRTKTLQMKTQFEEQLQATEEENEQAVSESYQKG
LAQGRAQASRSQAPSQDVVTEVKKIMNNVFHELKAEFAADTQYTGAEIMAVILRTIKMTL
RLINPNPEDEGVDEEDDDKDEVDEEEEEEEEDEEDEKEDEDEEQEEDEVHDKDEDSEGER
EPQIKDNGVRIDTVKDTLNELNVCQTEDYVVKQKHDIADKDEDEEEEEEAAGEKHENKSE
LKQSNTDQINNENINVKSNTDSLTRVDQVVHEAESEDTKTSEDVEHVTIIDVTDDNLQDE
HLKHESGEDKVIEAVEGTEQLETVEQSPEIFDTPDQSKHDEEVTRDQRGSDVSSESDQEH
EGPPPLDDNEDVQSAHEPSAETADPPKNLSPSDAVDASDKLKSLFGDDSHDDVKDIFVPK
PKIDLTDEPPSKPIPPPLFDDDDEDDDIDWFK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcggaagcaactgtcctcaagacacagctggcaaacgctcagactgagcttcag
agcttacggaaacaagaggcggaaatgcgaacagtgatgaacaaagctacttcagagagc
gagagatttcgcgtagagcttgagagccttaaagaatcactttctgagagtcaacttcac
acagagaaactaaaacaagacctgaaagaggaaaaacagacaagaaagagagtcgagagc
cgtgctgaccatgtagaggaagaaatggcagatttacagcacgagaaagacaaacttgaa
aagagcgttgctgaccgcaaaaagaaacacacccaagatcggcggaagtttgaagaagag
ctagaagagctgagagctcagcacgaggatgagatcaagtccctcaaggagaagcaccgg
cgggagaagaaaaactcgggaagcgtcactactgaagagatttccaagatggagagcgat
ctggagactcgatggaccgagaaggcgacaaagatggtctctcaggccgtggagaaatgg
aaaaggaagtatgatgatgttatcgaagaacgagacgaagccgcgaggaaacttacgacc
ttggaagacaagttaagctcattgaagtccatcgaagaaaagaaaaatgaggaagtaaac
aacttgcaagagaaaattgacgagctgcagaatttacaggaaaaatttaccagtgcaacg
tctacaggacaagaaaaagacgttgagattgagcgactgaagatcgcggtacaggaactc
gaggaggcgagagagaagatgagaaccaagactctgcagatgaaaacacagttcgaggaa
caacttcaagcaaccgaagaggaaaacgagcaggccgtgtcggaatcttaccaaaaaggc
ttagcacaaggtcgtgcccaggcctccaggagccaggcaccttcccaagatgtcgtcact
gaggtgaagaaaatcatgaataatgtattccacgagctgaaagctgagtttgccgcggac
acgcagtacacgggcgccgagatcatggccgtcatattacgaactataaagatgaccctg
aggctcattaacccgaatcctgaagatgaaggcgtcgacgaagaagatgatgacaaggat
gaggttgacgaggaagaagaggaggaagaggaagacgaagaggatgaaaaggaagatgag
gacgaagagcaggaagaagacgaagttcatgataaggacgaagacagcgagggtgaacga
gaacctcagataaaagataacggtgtaagaatagatacagtaaaggatactttaaatgag
ctcaatgtatgtcaaacggaagactatgtggtcaagcaaaaacatgacatcgcagataag
gatgaggatgaggaggaggaggaggaggcggcgggagaaaaacacgaaaataaaagcgaa
ctaaagcagtctaatactgatcaaatcaataacgaaaacataaacgttaaatctaatact
gattcattaactcgtgttgaccaagttgttcatgaagctgagtcagaagatactaaaaca
tcagaagatgtcgaacatgtaactataattgacgtaacagatgataatctacaagatgag
catttaaaacatgagagtggagaagataaagttatagaagctgtagagggaactgaacag
ttagaaacagtagaacaatcaccggaaatctttgatactcccgaccaaagtaagcacgac
gaagaggttacacgtgaccaaagaggaagtgacgtcagtagtgaaagtgaccaggagcat
gaaggtcccccgccattggatgacaatgaagatgttcaatctgcgcatgagccaagtgca
gaaactgctgacccaccaaagaacttgtctccttcagatgcagtagatgcttctgataag
ttgaaatcattgtttggagatgacagccatgacgacgtcaaagacatctttgtcccaaag
ccgaagatagatctcacggatgagcccccatccaagccaattcctccacctttatttgat
gacgatgacgaggatgatgacattgattggttcaagtaa

DBGET integrated database retrieval system