KEGG   Nasonia vitripennis (jewel wasp): 100114919Help
Entry
100114919         CDS       T01081                                 

Gene name
SP12
Definition
(RefSeq) trypsin-7
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100114919 (SP12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nvi01002]
    100114919 (SP12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100114919 (SP12)
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100114919 (SP12)
Peptidases [BR:nvi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100114919 (SP12)
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100114919 (SP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Peptidase_S55
Motif
Other DBs
NCBI-GeneID: 100114919
NCBI-ProteinID: XP_016838732
NASONIABASE: NV17678
LinkDB All DBs
Position
1
AA seq 276 aa AA seqDB search
MCYDNRALVCAALILLLAEFTSVQSLPDLAVLDDLFRDARVEDNPDDGRVVGGYETSIEQ
HPYQVSLRYKGRHKCGGAIIAEDWVITAAHCLKSSNPSHLSIKAGSSTLGGRGQVVDVHH
VIRHEDYSRRESDYDIALLQLESPLALGSKIQPIELAEAADYYSTGSKASVTGWGVEESS
GELSNYLREVSVPLISNSECSRLYGQRRITERMLCAGYVGRGGKDACQGDSGGPLVQDGK
LIGIVSWGFGCAEPNYPGVYTRVTALRSWISEIAGL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtgttacgataaccgtgctctcgtttgcgctgcgctgattctcctcctcgcggagttc
acttcggtgcagagtctgccggatttggctgttctagacgatctttttcgggatgcgagg
gtcgaggataatcccgacgacggccgcgtcgtcggcggctacgagaccagcatcgagcag
catccctaccaggtgtccctgcgctacaagggccggcacaagtgcggcggagccatcatc
gccgaggactgggtgatcaccgcggcgcattgcctcaaatcctcgaacccgagccacctg
agcatcaaggcgggctcctcgaccctgggcggccgcggccaggtggtggacgtgcaccat
gtgatccgccacgaggactactcgcgccgcgagtccgactacgacatcgccctcctccag
ctggagtcgccgctcgcgctgggcagtaaaatccagccgatcgagttggccgaggccgcg
gactactattcgacgggaagcaaggcctcggtaaccggctggggcgtcgaggagagtagc
ggcgagctgagcaattacctgcgcgaggtctcggtgcctctcatttccaactccgagtgc
tcccggctttacggccagcgtcgcatcaccgagcgcatgctgtgcgccggctacgtcggc
cggggcggcaaggacgcctgtcagggcgacagcggcgggccactggtgcaggacggcaag
ctcatcgggatcgtgtcctggggattcggctgcgccgagcccaactacccgggcgtttac
acgcgggtcacggcgctgcgctcctggatcagcgaaatagccggtctctaa

DBGET integrated database retrieval system