KEGG   Nasonia vitripennis (jewel wasp): 100115310Help
Entry
100115310         CDS       T01081                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00010  Glycolysis / Gluconeogenesis
nvi00030  Pentose phosphate pathway
nvi00051  Fructose and mannose metabolism
nvi00052  Galactose metabolism
nvi01100  Metabolic pathways
nvi01200  Carbon metabolism
nvi01230  Biosynthesis of amino acids
nvi03018  RNA degradation
Module
nvi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100115310
   00030 Pentose phosphate pathway
    100115310
   00051 Fructose and mannose metabolism
    100115310
   00052 Galactose metabolism
    100115310
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100115310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nvi01009]
    100115310
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nvi03019]
    100115310
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100115310
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100115310
Messenger RNA biogenesis [BR:nvi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100115310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100115310
NCBI-ProteinID: XP_001600070
NASONIABASE: NV12083
UniProt: K7ISN4
LinkDB All DBs
Position
5
AA seq 788 aa AA seqDB search
MDEEQVAHRFIKPGSHRGKGLAVFTSGGDSQGMNAAVRAVVRMGIYLGCKVFFIREGYQG
MVDGGDNIVEANWSSVSCIIHRGGTVIGSARCMEFREREGRKRAAKNLVTRGISNLCVIG
GDGSLTGANLFKEEWADLLKELVKDGEITLEQSEKYKHLHIVGLVGSIDNDFCGTDMTIG
TDTALHRIIESIDAIASTAYSHQRTFIMEVMGRHCGYLALVAAMCSEADYVFIPEWPPEQ
DWPNKLCKKLIQERLTGQRLNIIIVAEGALDRNGDPITAEKVRQVVVEKLQQDTRITVLG
HVQRGGNPSAFDRVLGCRMGAEAVMALVEATPETEACVVTLDGNQAVRLPLMECVRRTKA
VAQAMADKNWDLAVQLRGKGFVRNLETYKMLTRLKAPVEIDPNKDHYTLAVMHVGSPSCG
MNAAVRSFVRNCIYRGDKVYGIMDGVLGLATGKLKLMDWPSVTGWVAQGGAYLGTKRAPP
KDDQLPLIAQKLKEFGIQALLIIGGFEGFQTGLSFYNARTQHPEFRIPIAMIPATISNNV
PGTEFSLGCDTALNEITEICDRIRQSAQGTKRRVFIIETMGGFCGYLATLAGLAGGADAA
YIFEEKFNIKDLNQDIIAMAAKMSEGVQRGLILRNESANSNYNTEFMQRLFTEEGKGLFS
CRMNIIGHMQQGGSPTPFDRNLGTKMGAKAVEWFTERLKKDTTADGQAVSNSDESAVMLG
IVRRQYRYTPFSKLIDTTDFEHRIPTYQWWMKLRPLLKVLAKHESTYEEEGLYITVEEMD
KNNDAPLV
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagaacaggtggcccacaggtttattaaacctggcagtcacagagggaaaggc
cttgctgtttttaccagtggtggcgattctcagggtatgaatgctgctgtccgtgctgtt
gttcgcatgggcatctacttagggtgcaaagttttcttcattagagaaggttaccaagga
atggtggacggtggtgacaatatcgttgaggccaactggtcctctgtgtcttgcatcatc
catcgtggtggcacggtgatcggctcggcccgttgcatggaattccgagagcgtgaaggt
agaaagagggcggccaagaatttggtgacacgcggtatatccaacttgtgcgtcattggt
ggagacggctctctgaccggtgccaatctcttcaaagaagaatgggccgatctgttgaaa
gaattggtgaaagatggcgaaatcacactggagcaaagcgaaaaatacaagcatttgcac
atcgtcggtctggttggctcgatcgacaatgacttttgcggaacggatatgaccatcggt
acggacaccgcgctacacaggatcatcgaaagcatcgatgccatcgccagtactgcctac
tcgcaccagcgtaccttcattatggaagtaatgggccgtcattgcggctatctggctctg
gtggcagctatgtgtagcgaagcagactatgttttcatcccagaatggccgccggagcag
gattggccgaacaagctctgcaaaaagttgattcaggagcggctgacgggtcagaggctg
aacatcatcatcgtggctgagggtgccctcgacagaaacggtgaccccatcaccgctgag
aaggtgcgccaggtcgtcgtcgagaagcttcagcaggacacgagaatcacggttctcggc
cacgtccaacgcggtggcaatccctcggccttcgatcgcgttctcggctgccgtatgggt
gccgaggccgtgatggcactggttgaggcgacccccgaaacggaagcctgcgtcgtaaca
ttggacggcaaccaggccgtacggctgcctctgatggaatgcgtacggcgcaccaaggct
gtggcccaggctatggctgacaagaactgggacttggctgtacagctacgtggaaagggc
ttcgtccgaaacctcgagacctacaagatgctaactcggctcaaagctcccgtcgaaatc
gaccccaacaaggaccattacacattggcggtgatgcacgtcggttcgccgtcatgcggc
atgaacgccgctgtgcgttctttcgtgagaaactgcatttaccgcggtgacaaggtatac
ggtattatggacggtgttctgggcttggcgacgggcaagttgaagctcatggattggccc
tcggtgacgggttgggtcgctcagggtggcgcctatctgggtactaaacgagccccaccc
aaggacgatcaacttcctctaatcgctcagaaactgaaggagtttggaattcaggctctt
cttataattggtggtttcgagggatttcaaaccggtcttagtttctacaacgccagaact
cagcacccagaatttcgcatccccattgccatgattcctgccactattagtaacaatgtt
ccgggaaccgagttttctctgggttgtgatacagctctcaatgaaattaccgagatttgc
gaccgtatcaggcagtcggctcagggtacaaagcgccgcgtttttatcattgaaactatg
ggcggattttgcggttatcttgccaccctggcgggactggcaggtggtgccgacgcggcc
tacattttcgaggaaaaattcaacatcaaggatcttaaccaagatatcatcgcgatggct
gccaaaatgtccgagggagtgcagcgcggtctaattctgcgtaatgagagtgccaactcg
aattacaataccgagttcatgcaaaggctcttcaccgaagagggtaaaggacttttcagc
tgcagaatgaatataatcggtcacatgcagcaaggtggttcgcccactccgtttgatcgt
aatttgggcactaagatgggagccaaggctgtcgaatggtttacagagcgattgaagaag
gataccacagccgatggacaggcggtttctaatagcgacgagagtgccgtaatgctgggt
attgtcagacgtcagtacagatatacgccgttcagcaaactaatcgataccactgatttc
gagcacagaatccctacatatcagtggtggatgaaactgcgtccactgctcaaagtattg
gcaaagcatgagtcgacctacgaggaagagggtctctacatcacggtcgaggaaatggac
aagaacaatgacgcaccgctagtttaa

DBGET integrated database retrieval system