KEGG   Nasonia vitripennis (jewel wasp): 100118011Help
Entry
100118011         CDS       T01081                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nvi01002]
    100118011
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100118011
   04090 CD molecules [BR:nvi04090]
    100118011
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100118011
Peptidases [BR:nvi01002]
 Metallo Peptidases
  Family M2
   100118011
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100118011
CD molecules [BR:nvi04090]
 Proteins
  100118011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100118011
NCBI-ProteinID: XP_016841750
NASONIABASE: NV12891
LinkDB All DBs
Position
5
AA seq 653 aa AA seqDB search
MKILGIVLLLVVGAQGSLARYLEGLNVNLGEALQFLREYDREASSVCNRVMTAQWNFATN
ITDSNRRKMLEEQTVKLKFERASWRKTVSFAWNRIADPLARRQLKIIAVKGRNSLTDDKF
NEMHHLIMEMKELYNRVRLCPYRKIGATCDLTFDADVMRIMSQSRDYDELLHYWQAWHEA
VGPPLKNKYVRYVQLANQAAKLNGFADAGDQMREIYEDDYFQQNIAEVISAITPLYKHLF
TYVRSRLIERYGDRIRNDGPLPAHILGNMWAQNWENLFDLVQPFPAVKKLDVTLDMMIQG
FTSLRIFQMAEEFFTSMGMKPMPPEFWRSSMFEKPIDREVKCSSSAWDFCNKIDYRIKQC
TKITTDDLVSTHHEMAHVQYYLQYKDQPYIFRGEALPGFHEAVSNAIGLSVFTPQHLHRI
GLYNNATDDYESNINFLMLMALQKVAYLPFAYIVDQWRWRVFSDGVTDMTTRWWELRLQY
QGIVPPIPRTERDFDPASKYHVPADLPYSNYFVSVILQFQLFESLCDISGHTGDLHTCDL
YRSREAGRLLSDVLSVGSSMPWPDIIRLMTRGRTNRIDAGAMLRYFQPLTQFLRRQNQIE
PVIGWVISQEDTDFPTSFTALFAHWYLGSANTIASSVTILPTVLLVCFHWLQL
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgggaattgtcctgctgctggtcgtcggtgcccagggaagcttggctcgg
tatcttgagggtttgaacgtgaacctgggagaggcgcttcaattcctcagggaatatgat
cgggaggcttcctcggtgtgcaacagagttatgacggcgcaatggaatttcgctacaaat
attaccgattcaaatcgaaggaaaatgctggaggagcagacggtaaaactgaaattcgag
agagcgtcttggcgaaaaactgtgagctttgcttggaaccgaatagccgatccactggca
agaagacaactgaaaattatcgccgtcaaaggacggaattcactgaccgatgacaagttc
aacgaaatgcatcatttaatcatggagatgaaggaattatacaaccgagtgagattatgt
ccatacagaaaaataggagctacttgtgacttgacattcgatgcagacgtcatgaggata
atgtcgcaatcacgagactacgatgagctgctgcactactggcaggcttggcacgaggcc
gtcgggccacctttgaagaacaagtacgtaagatacgtccagttggcaaatcaggccgcg
aaactcaatggatttgccgacgcaggtgaccagatgcgcgagatttacgaagacgactat
ttccagcagaacatcgccgaggtcatctccgcgatcacacccctttacaaacacttgttc
acttatgtgagaagccgattaatcgagcgttacggcgacaggattcgcaacgatggacca
ctaccagcccacatattaggcaacatgtgggcccaaaattgggagaatctctttgacctg
gtgcaaccattcccagcagtcaaaaagctggatgtcactttggacatgatgattcaggga
ttcacgtcgcttagaatttttcaaatggccgaggaatttttcacgtcgatgggaatgaag
cctatgccaccggagttctggagatcgtcgatgttcgagaagccaatcgacagagaagtc
aagtgcagctcaagtgcctgggacttttgcaataaaattgattacagaatcaagcagtgc
accaaaataacaacagatgatttagtgtcgactcatcatgagatggctcacgtgcagtac
tacttgcagtacaaggatcagccctatatctttcgaggcgaagccctgcctggatttcac
gaggcagtaagcaatgccataggcctatcagttttcacccctcaacacttgcacagaatc
ggcctctacaataacgccactgacgattacgaaagcaacataaactttttgatgctcatg
gctttgcagaaagtcgcatacttgccattcgcgtacatagtagatcagtggaggtggcgc
gtattcagtgatggcgtgacggatatgacgacgcgatggtgggagctgagattgcagtat
cagggcatagtaccgcctatcccgcgaacggaaagagacttcgacccggcatccaagtat
cacgttccagcggatcttccttattcaaattatttcgtgtcagtaatactacaattccag
ttattcgaatcgctatgtgatatatccggtcacacaggtgatttgcacacttgcgatctc
tatcgatcacgagaagccgggcgtttactttcagacgtattgtccgtgggttcgtcgatg
ccctggccggacataatcaggctgatgactcgaggtcgcaccaatagaatagacgccggt
gccatgctgcgatacttccaacctctgacccaattcctcaggcgacagaaccagatcgag
ccggtgatcggctgggtcatcagtcaagaagatacagacttccctacttcgtttacagcc
ttgttcgcccactggtacctaggcagtgcgaacaccatcgcctcctccgtaacaattcta
ccaactgtgttacttgtctgcttccactggctacagctctga

DBGET integrated database retrieval system