KEGG   Nasonia vitripennis (jewel wasp): 100119074Help
Entry
100119074         CDS       T01081                                 

Gene name
Sdha
Definition
(RefSeq) succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00020  Citrate cycle (TCA cycle)
nvi00190  Oxidative phosphorylation
nvi01100  Metabolic pathways
nvi01200  Carbon metabolism
Module
nvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nvi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100119074 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100119074 (Sdha)
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100119074 (Sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like Lycopene_cycl DUF4061 NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 100119074
NCBI-ProteinID: NP_001165801
NASONIABASE: NV12395
UniProt: K7ITI9
LinkDB All DBs
Position
3
AA seq 661 aa AA seqDB search
MSGLLKLSGLLAKGLPSTTLNKLGLPIISQRALHYTPNSGFAKTSDGISQNYPVVDHTFD
AVVVGAGGAGLRAAYGLVEEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEEDNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTTEGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSFDCNYFIEYFALDLLMEDGECRGVIALCLEDGT
LHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDH
IYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVLT
SKNNQDSVVPGLYACGESACASVHGANRLGANSLLDLVVFGRACAKTISEENKPGEKIGS
LRTNAGEESVANLDKIRNAKGNISTAELRLTMQKTMQTHAAVFRQADTLQEGCKKMSALY
KKLDDLKITDRSLVWNSDLIETLELQNLMVNAMQTIYAAENRKESRGAHAREDFKDRIDE
YDYSKPLEGQQPKPLDQHWRKHTLTHVDINTGDVKIDYRPVIDHTLDDKECKTVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcggactgctgaagctctcgggcctcctggccaagggcctgccctcgacgacgctg
aacaaattaggcctacccattatcagccaacgggctctacattacacacccaacagtggt
tttgctaaaacttcagatggaatttcgcaaaactaccctgtagtcgatcatacttttgat
gcagtggtagttggtgctggtggtgctggtctccgagctgcctatggtctagtcgaggag
ggtttcaagactgctgtggtcaccaaattatttccaacaagatctcacactgttgctgcc
caaggaggtatcaatgcagcgcttggaaatatggaggaagataattggcagtggcacatg
tatgacacagtcaagggttctgattggcttggagatcaagatgccattcactacatgacc
agggaggccccaaaagctgtgattgaattagaaaattgcggcatgcctttcagtcgaact
actgagggtaaaatctaccaacgagccttcggaggtcaatctctcaagttcggcaaggga
ggtcaggctcatcgttgctgctgcgtcgccgacagaacgggacactcgcttctgcataca
ctgtacggacagtctctaagtttcgattgcaattacttcatcgagtacttcgctctggac
ctgctgatggaggatggtgagtgtcgaggcgtcatcgctctctgcctcgaggatggcacg
ctccaccgtttccacgccaagaacacggtgctggccaccggtggatacggtcgtgcttac
ttctcctgtacgtccgcccacacttgtactggtgacggtactgctatggtctctagggcg
aacctgcccaaccaggatcttgagttcgtgcagttccatccgaccggtatctatggtgct
ggttgcctgatcaccgagggcagcagaggagaaggtggctacttggtgaacagcgagggt
gagagatttatggagcgttacgctcccgtggccaaggatctcgcgtctcgagacgtagtc
tcaagatccatgaccatcgagatccgcgaaggcagaggagtcggtcccgagaaagatcac
atttacctgcagttgcatcacctgccaccagagcagctcgctgccaggctacccggaatc
tccgagacagcgatgatcttcgctggagtcgacgttacacgcgaaccaatccctgtgtta
cccactgtgcattacaatatgggtggcgttccaacgaattacagaggacaagttttgacg
tccaagaacaaccaagactcggtggtaccaggcctctatgcttgcggtgaatctgcttgc
gcctccgtccacggagctaaccgacttggtgctaactcgctgctggatctggttgtattt
ggcagagcttgcgcgaagaccatttctgaggagaacaagcctggcgaaaagattggaagc
ctccgaactaacgctggagaagaatcagtagcaaacctcgataaaataagaaatgctaaa
ggaaacatctcgactgctgaattaagactgactatgcagaagactatgcagactcacgcc
gctgtctttaggcaggctgacaccttgcaagaaggttgcaagaaaatgtcggcgttgtac
aaaaagctggatgaccttaaaattaccgatagatccctcgtctggaattctgacctgatc
gagaccctcgagcttcagaatctgatggtcaatgcaatgcagacaatctacgccgcagag
aaccgcaaggagagtcgtggtgcccacgcacgagaggacttcaaagacagaatcgacgag
tacgattacagcaagccactcgaaggacagcagcccaagcctttggatcagcactggcga
aagcatactctcacgcacgtcgacatcaacactggagacgtcaaaatcgactacaggcct
gttatagaccacacactagacgacaaggaatgcaaaactgtaccacctgcaattcgttct
tattag

DBGET integrated database retrieval system