KEGG   Nasonia vitripennis (jewel wasp): 100119087Help
Entry
100119087         CDS       T01081                                 

Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100119087
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nvi04090]
    100119087
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100119087
Protein kinases [BR:nvi01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   100119087
Cytokine receptors [BR:nvi04050]
 Receptor tyrosine kinase
  RTK class X (LTK receptor family)
   100119087
CD molecules [BR:nvi04090]
 Proteins
  100119087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr MAM Pkinase Gly_rich Ldl_recept_a Ninjurin
Motif
Other DBs
NCBI-GeneID: 100119087
NCBI-ProteinID: XP_008203723
NASONIABASE: NV14367
LinkDB All DBs
Position
3
AA seq 1460 aa AA seqDB search
MQARGLRPGRLLPLLGLALAVLAGLMQAGAERRGARGSLKDLQLLLKSKPAGSPTLGQCD
FDRVCDWFWNATDGSFQLVKPPLPTQLGPSTDASRRPDGKFLYMPGPGVGQLASRVIPRT
GSNCYLEVALYQVAMKRGTINLVIETFNKTSYLASMRSGNDNATWERSKFHLGSLNQEFS
IILEMQAPFDNSSIAVDDIDLVNCFPESRSYECTESMFRCNNGSCLKREHVCDLTADCAD
GEDETGDCDKVPEHAKCNFEGGWCGWSNVRGRPLNWTLHQGPMPSERMGPVADHTYRNGT
GTYAYVDMSKTDLQLGSRATINSPIFNPTPPYNHQPGSPYKNSCKVRFFYHQYGSHTVPL
GLYLVQLKPQQNYSQQIWRYVKDNSDSWNSQLVTLPDVRYRYYLQFEASKSYASKAVVAI
DDISLSPECFGVGVPADILADFNYYDQKIPPEGSVPPKHADFTNKTIVRVSSCGQTGRIG
PTPEQCVDQQNGSDALVEVLSGTSTDEGDASLRFKGIQRWIAPSGGYYTIIAMGARGGAG
ALSMGVTMGAMVRGVIELEKGQQLYFMVGQPGTDACPKSLGAKNDTCSQPGGRNASNEYV
SIMKQVKNIEFRDGGGGGGGATYIFTLKPNGEQQPLLIAGGGGGLGPTQFRDDGVQHAKG
ATPPDRAPYNGVSFKKNAGGGGGWIASSANETSHGPNGMALTKGGIGGIGCGPNNDKGHG
DGGFGGGGGGCLSGGGGGGYAGGDTGQVESGNGEGGYSFASADLLHVSFAEKANAGPGEV
LIIPAISGCGCDFRCVVVDRHLSETHCLCPAGWQLGNDSKACVTVSEPDPRHQTVMVVLI
IVSIGLIIAFSGLCFLLYNRYQNRKELERRRQVMFGNGTELTSLRVVSDSMMTEFNPNYE
FAGNLYSFKDLPQIPRDSVTLVKPLGQGAFGEVFQGVYKYSRSEEHPVAVKTLPSVSTSQ
AEADFMMEALIMSKFEHPNIVQFIGISFDKHPRYIVLELLAGGDLKNFLREERPRPDRPT
TLTMQSLIMCAYDVAKGCKYMEEARFIHRDIAARNCLLSCKGPGRVVKIADFGMARDIYR
SDYYRKGGKAMLPIKWMPPESFLDGIFTTKTDVWAFGVLLWEIMSFGYMPYTGCANREVM
SMVTSGGRLERPAGCPDPIYGIMTRCWHPHPEERPSFSSIVERIGYCLQDPDVINHPTPN
YDLLPICEREITIMRPDPETECINVQADLDGCGYVQPRLNLRPAKYRIGQPAGIVYASLR
HGSEDRENRNGPQQPQASPEGSPAREHELDDVCDNREQCQRLEEAAEPNANPRDGGDEKP
AAEQGEARGQNGNNGESTTTTDTNSDSIFMPSSRTPPDTASSSPNTRTSSPNHAAGGPLD
NGNSGNSGNPNNNVNGVIRKSALKAALSLDPSALCRGAIPYEKMAFSPPKPRLSNPGSAE
LARKDSLSSHGLPREEECSC
NT seq 4383 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgagggggctccggccgggccggctgctgccgctgctcggcctcgccctggcc
gtcctcgcgggactgatgcaggcgggagccgagcggcggggcgcgcgcggcagcctcaaa
gacctccagctgctgctgaagagcaagcccgccggcagcccgactctcggccagtgcgac
ttcgacagagtctgcgactggttctggaacgcgacggacgggagcttccagctggtgaag
ccgccgctgccgacgcagctggggcccagcaccgacgccagcaggcggcccgacggcaag
ttcctctacatgcccggcccgggcgtcggccagctggcctcgagagtgatcccgcgcacc
ggctccaactgctacctcgaggtcgcgctctaccaggtggcgatgaagcggggcacgata
aacctcgtcatcgagaccttcaacaagacctcctacctggcgagcatgcgctcgggcaac
gacaacgcgacctgggagaggagcaagttccacctgggcagcctcaaccaggagttcagc
ataatcctggagatgcaggcgcccttcgacaactcgagcatcgccgtcgacgacatagac
ctggtcaactgcttcccggagtcgcgcagctacgagtgcaccgagagcatgttccgctgc
aacaacggctcctgcctgaagcgcgagcacgtctgcgacctgacggccgactgcgccgac
ggcgaggacgagaccggcgactgcgacaaagtgccggagcacgccaagtgtaactttgag
ggcggctggtgcggctggtcgaacgtgaggggccggccgttgaactggacgctgcaccag
ggcccgatgccgagcgagaggatgggccccgtggccgaccacacctaccgaaacggcaca
gggacctacgcctacgtggacatgtcgaagacggacctgcagctgggcagccgagcgacc
atcaacagcccgatcttcaacccgacgccgccgtacaaccaccagcccggcagcccctac
aagaactcgtgcaaggtgcgcttcttctaccaccagtacggctcgcacacggtccccctg
ggcctgtacctcgtgcagctcaagccccagcagaactacagccagcagatctggcgatac
gtcaaggacaacagcgactcctggaacagccagctggtcactctgcccgacgtgcgctac
aggtactacctgcagttcgaggcgagcaagagctacgcctccaaggcggtcgtcgccatc
gacgacatctccctcagtcccgagtgctttggcgtcggcgtaccggccgacattctcgcc
gacttcaactactacgaccagaagattccgccggagggcagcgttccgccgaagcacgcc
gacttcaccaacaagacgattgtccgagtgagcagctgcggccagacgggcagaatcggc
ccgacgcccgagcagtgcgtcgaccagcagaacggctcggacgcgctggtcgaggtgctg
tcgggcacgtcgacggacgagggcgacgcctcgctgcgcttcaagggcattcagcgctgg
atcgcgcccagcggtggctactacacgatcatcgcgatgggcgcccgcggcggggccgga
gctctctcgatgggcgtcacgatgggcgcgatggtgcgcggcgtcatcgagctcgagaag
ggccagcagctctacttcatggtgggccagcccggcacggacgcctgtcccaagagcctg
ggcgccaagaacgacacgtgctcgcagcccggcggccggaacgccagcaacgagtacgtc
tccatcatgaagcaggtgaagaacatcgagttccgagacgggggaggcgggggcggcgga
gccacttacatcttcaccctgaagccgaacggcgagcagcagcctctgctgatcgccggg
ggcggcggaggactcgggccgacgcagttccgcgacgacggcgtccagcacgccaagggc
gcgactccgcccgacagggctccctacaacggcgtgtccttcaagaagaatgccggtgga
ggcggcggctggatagcctcgtcggcgaacgagactagtcacgggccgaacggcatggcg
ctgaccaagggcggcatcggcggcatcggctgcggcccgaacaacgacaagggccacggc
gacgggggcttcggcggcgggggcggcggctgcctctccggcggcggcgggggcggatac
gcaggcggggacaccggccaggtcgagtcgggcaacggcgagggcggctactcgttcgcc
tcggcggacctgctccacgtctccttcgcggagaaggccaacgccgggcccggcgaggtt
ctcatcatcccggcgataagcggctgcggctgcgactttcgctgcgtcgtcgtcgacagg
cacctcagcgagacgcactgcctctgcccggcgggatggcagctcggcaacgacagcaag
gcctgcgtcacagtgagcgagccggacccgcgccaccagaccgtcatggtcgtcctcata
atcgtgagcatcggcctgatcatcgccttctccggactctgctttctgctatacaaccgc
taccagaaccgcaaggagctcgagaggaggcgccaggtgatgttcggcaacggcaccgag
ctcacctctctgcgcgtcgtctccgacagcatgatgaccgagttcaaccccaactacgag
tttgccggaaacctctacagcttcaaggacctgccccagataccgcgggacagcgtcacc
ctcgtcaaacccctgggccagggcgcgttcggtgaagtcttccaaggcgtctacaagtac
agccgcagcgaggagcacccggtggccgtgaagaccctgccatcggtctcgacgtcccag
gccgaggcggactttatgatggaggcgctgataatgagcaagttcgagcacccgaacatc
gtgcagttcatcggcatatccttcgacaagcacccgcgctacatcgttctcgagctgctc
gccggcggcgacctgaagaactttctgcgcgaggagcggccccgaccggaccgtccgacg
acgctgaccatgcagagcctcattatgtgcgcgtacgacgtggcgaagggctgcaagtac
atggaggaggcgcgcttcatccaccgggacatcgcggcgcgcaactgcctgctcagctgc
aagggtcccggccgagtcgtcaaaatcgcggactttggcatggcccgggacatttaccgg
agcgactactaccgcaagggcggcaaggccatgctgcccatcaagtggatgccgcccgag
agcttcctcgacggcatcttcaccaccaagactgacgtctgggcgttcggcgtgctgctc
tgggagatcatgtccttcggctacatgccctacacgggctgcgcgaatcgcgaggtcatg
tcgatggtcacgagcggcggcaggctggagaggcccgcgggctgtcccgacccgatctac
ggcataatgacgcgctgctggcacccgcacccggaggagcggccgagcttcagcagcatc
gtcgagcggataggctactgcttgcaggacccggacgtgataaatcacccgacgccgaac
tacgacctcctgccgatttgcgagcgggaaatcacgatcatgaggcccgaccccgagacc
gagtgcataaacgtgcaggcagacctggacggctgcggctacgtgcagccgcggctcaac
ctccgcccggccaagtaccggatcggacagccagccggcatcgtgtacgcctcgctgagg
cacggctcggaggatcgcgagaaccgcaacgggccccagcagccgcaggccagccccgaa
ggctcgccggcccgcgagcacgagctcgacgacgtctgcgacaacagggagcagtgccag
cggctcgaggaggccgccgagcccaacgcgaacccgcgcgacggcggcgacgagaagccg
gcggcggagcagggagaggctcgcggccagaacggcaacaacggcgagagcaccacgacc
accgacaccaacagcgactcgatattcatgccctcctcgaggacgccgccggacacggcc
tcctcctcgcccaacacgcgcacctcctcgccgaaccacgcggccggcggacccctggac
aacggcaacagcggcaacagcggcaatcccaacaacaacgtcaacggcgtcatccgcaag
agcgcgctcaaggccgcgctgagcctcgaccccagcgccctgtgccggggcgcgataccc
tacgagaagatggccttctcgccgcccaagccgcggctcagcaatcccggcagcgcggag
ctcgcgaggaaggactcgctgagcagtcacgggctgccgcgcgaggaggagtgctcctgc
tga

DBGET integrated database retrieval system