KEGG   Nasonia vitripennis (jewel wasp): 100119226Help
Entry
100119226         CDS       T01081                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00500  Starch and sucrose metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100119226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nvi01003]
    100119226
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100119226
Glycosyltransferases [BR:nvi01003]
 Polysaccharide
  Storage polysaccharide
   100119226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100119226
NCBI-ProteinID: XP_016842079
NASONIABASE: NV18086
LinkDB All DBs
Position
1
AA seq 691 aa AA seqDB search
MSRNASKRFYRLGSNQELLDYMSPNENPEQENRWNFEVSWEAANKVGGIYTVIRSKAYVS
VEEMGDQYCLLGPYKENCAKTEIEEMDFPLNSPIYKTVQILRDQGYKVITGTWLVDGNPQ
IILFDIGSAAWKLDEYKQELWNCCNFGIPHMDVEANDAIILGYLVCQFISEFRKISGSNS
QFLPRIVVHCHEWQAGVALIALRTRHIDVATVFTTHATLLGRYLCAGKTDFYNNLNKFNV
DEEAGKRQIYHRYCMERAAAHMSHVFTTVSDITGLEAEHLLKRVPDIITPNGLNVKKFSA
LHEFQNLHAVNKEKIHEFVRGHFYGHFDFDLDKTLYFFIAGRYEFGNKGADIFIEALARL
NHYIKSSKSDVTVVAFLIFPARTNNFNVESLRGHAVTKSLRGTISDIQQKIGKRMYEACL
SGRMPENKDLCLKEDLMKIKRCLYALQRNGLPPITTHNIIDDWNDPVLNAIRRCNLFNTV
NDRVKVVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITT
NLSGFGCFMQDHVADPMSYGIYIVDRRFISLEASVQQLAQYMFDFCRLNRRQRIIQRNRT
ERLSDLLDWRNLGIYYQHARIKALIKMYPELASEFTESSVKCLNYPRPISEPSSPSSSRH
TTPAASVQGSDDEDEFDEEKELQELQQSDEK
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaatgcaagcaagcgtttttaccggttgggtagtaatcaggagctacttgac
tacatgagtccaaatgaaaatcccgaacaagaaaacagatggaattttgaagtatcttgg
gaagcagcgaataaagttggtggaatttacacagttattagatcaaaagcgtatgtatcg
gtagaagagatgggagatcaatactgcttattaggaccttataaagaaaattgtgcaaaa
acagaaattgaagaaatggattttccactcaacagtccaatatacaaaactgtccagatt
ttacgagatcaaggttataaagttatcacgggtacttggttagtcgatggaaatccacaa
ataattttatttgatattggtagtgcagcatggaaattggatgaatataaacaagaatta
tggaattgttgcaattttggtattccccatatggatgttgaagctaatgatgctataata
cttgggtatcttgtctgtcagtttattagcgaattcagaaaaatatcaggatcaaattcc
caatttctgccacgcattgttgtacattgtcacgaatggcaagcaggggtagcattaata
gctttacgcacacgacatattgacgtagctacagtatttacaactcatgccacacttctt
ggtagatatttatgtgctggaaaaactgacttttataataatttaaataagttcaatgtt
gatgaagaggcagggaagcgacaaatatatcataggtactgtatggaacgggctgctgct
catatgtcacacgtattcactacagtatccgatatcactggacttgaagctgaacattta
cttaaaagagtacctgatattataaccccaaatggattaaatgtgaaaaaattctcagct
ttacatgaatttcaaaatcttcatgcagtaaataaggaaaaaatacatgaatttgttcga
ggacatttttacggacatttcgattttgatttagacaaaacgttatatttttttattgct
ggacgttatgaatttggaaacaaaggagcagacatatttattgaagctttagcaagactt
aatcactatataaagtcctcaaaatctgatgttactgtagttgcgtttttaatattccca
gcaaggactaataatttcaatgtagaatcacttcgaggacatgcagtaactaaatcatta
agagggacaattagtgatatacagcaaaaaattggaaaacgtatgtacgaagcctgtttg
tcaggacgaatgccagaaaataaagatttatgccttaaggaggatctgatgaaaatcaaa
agatgtttatatgcactgcaaagaaatggacttccgccaataacaactcataatataatt
gatgactggaatgatcccgtattgaacgctataagacgatgtaacttatttaacacagta
aatgatcgtgttaaggtcgtatttcatccggaatttttgtcatctactaatccacttttt
ggattagactatgaagaattcgttcgtggatgccatctaggagttttcccttcctattat
gagccatggggatatactccagctgaatgtacagtcatgggaataccaagtataactaca
aatctttcaggatttggatgtttcatgcaagatcatgtggcggatccaatgagttacgga
atttacatagtcgatcgaagatttatcagtttagaagcaagtgttcaacaacttgctcaa
tatatgtttgatttttgccgtctaaatagacgccaaagaatcatacagcgaaatcggact
gaacgcttaagtgacttactagattggcggaatcttggaatttattatcagcatgctcga
attaaagcattaataaagatgtatcctgaactagcttctgaatttactgaaagcagtgtt
aaatgtttaaattatccaagaccaataagtgaaccttcttctccatcatcatcacgccat
actacaccagctgcatcagttcaaggatcggatgatgaagatgaattcgacgaagaaaaa
gaattgcaggaactccaacaatccgacgaaaaatag

DBGET integrated database retrieval system