KEGG   Nasonia vitripennis (jewel wasp): 100120667
Entry
100120667         CDS       T01081                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X2
  KO
K20017  Bcl-2 family protein
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04214  Apoptosis - fly
nvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100120667
   04215 Apoptosis - multiple species
    100120667
SSDB
Motif
Pfam: Bcl-2 CitMHS_2
Other DBs
NCBI-GeneID: 100120667
NCBI-ProteinID: XP_008210490
NASONIABASE: NV13205
LinkDB
Position
2
AA seq 320 aa
MLVAHTSSLADSRRRSAGTARARKRRPVSMVIMQHPPPQIRHTTSTEDVSAASSVAAAAA
LARSYRRSSLAATLHANFISLGGHPDAFDAARRRLSNVSDVVSRKISRTIGWRSLSVSVE
LTVSQGKALCGQYIRSRLRRSGIFHRKLGLKRVRSAKLISGSSVVEEVFPVLDALGTELE
KMHPQLYERVGRQIGRGLFNSEQKVSDALTDISREMLRAGECNWVKIASIYAVAGGIAVD
CVKQGKPEFLPVIQRAMIIVLEEYLASWIQANGGWTALVLKYRPAPRQTNWQAGAVIFFG
LVAVIWAILCFAVAFKASLL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgctcgtcgcgcatacgagctcgctcgcagactcgcgacgtcgttcggccggcacggct
cgagcacgcaagcgacgtcccgtgtcgatggtgataatgcagcatccgccgccgcagatc
cgacacacgacgtcgacggaggacgtgtcggcggccagttctgtggcggctgcggctgcc
ctggcccgcagctaccgcagaagcagtctcgccgcgacgcttcacgcgaacttcatcagt
ctcggcggacaccccgacgccttcgatgcagccaggcgtcggctcagcaacgtcagcgac
gtcgtctcgcgaaaaatatcgcgcaccatcggctggcgatcgctgtccgtctcggtcgag
cttacagtctcgcagggcaaagcgctctgcggccagtacatccgcagccgtctcaggcgc
tcgggcatcttccaccgcaagctgggcctgaagcgagtgcgtagcgccaagctgatatcg
ggcagcagcgtggtcgaggaggtcttcccggtgctggacgccctcggcacggagctcgag
aagatgcacccgcagctgtacgagcgcgtcggtcgccagatcggtcgcggtctcttcaac
agcgagcagaaggtctccgacgctctgaccgacatctcccgcgagatgctgcgggccggc
gaatgcaactgggtcaagatcgcctcgatttacgcggtggccggcggcatcgccgtggac
tgcgtgaaacagggcaaacccgagttcctgcccgtcatccagagagctatgatcatcgtc
ctcgaggagtacctcgcctcgtggatacaggccaatggtggatggactgctttggtactc
aagtacaggccggcgccgaggcaaacgaattggcaagccggcgcagtgatattcttcgga
ctcgtagccgtgatctgggctatcctctgtttcgcagtggcattcaaagcctctttactg
tga

DBGET integrated database retrieval system