KEGG   Nasonia vitripennis (jewel wasp): 100120914Help
Entry
100120914         CDS       T01081                                 

Definition
(RefSeq) maltase 1-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00052  Galactose metabolism
nvi00500  Starch and sucrose metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100120914
   00500 Starch and sucrose metabolism
    100120914
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100120914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase Cyc-maltodext_C
Motif
Other DBs
NCBI-GeneID: 100120914
NCBI-ProteinID: XP_001604507
NASONIABASE: NV12204
UniProt: K7IT01
LinkDB All DBs
Position
5
AA seq 566 aa AA seqDB search
MSLKLCCTILFIAGLAAGEIKNKGWWKNTVFYQVYPRSFMDSNGDGIGDLKGITNKLEHF
VESGIGGIWLSPIYASPMVDFGYDISDFRAIDKAYGTMEDLEQLTAKARKLGVKVVLDFV
PNHTSNEHPWFIKSYQGIGKYKDYYTWRRGRDNNKQPPNNWISLFSGPAWTYNATRDLWY
FHQFEYRQPELNYSNPNVRQEMEDVLRFWLSKGVDGFRVDAVPHLFEKEGLPDEPLSHKP
GVSNQSDSYLEHIYVKDDPRSYDLIKTWRKLVDDWSDLHNEDEKVIMTEAYTNLDNTTKW
YQYGSDIPFNFNLITEVDNTSKPIDFKKVIDDWMVRTPSTGSANWVMGNHDRSRIGTRYP
GRADQMTMLAMILPGVAVTYYGEEIGMVDKLDITWEATQDPQACNTDPERYRAVTRDPNR
TPFQWDDTKNAGFSNASTTWLPVNDNYKELNLAKQKLQQESHYKLYQTLTKLRSTSLALK
NGTLDTVVLNNNSVLAVIRKIADEAVVLLINFSNDSPQSVDVSEYLPNAKDATVKGASVG
SGIEWGSIIKTSDVRLPPKASIVLVR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaaactgtgttgcacgattttatttatcgctggccttgcagctggtgaaata
aaaaataaaggatggtggaagaatacagttttttatcaagtttatccccgtagttttatg
gattcaaatggcgatgggattggtgatctaaaaggtattacgaataagctcgaacacttt
gtcgagtctggcattggcggaatatggctttcgccaatatacgcaagccctatggtcgat
ttcggctacgacatttccgatttccgtgctattgacaaagcttacggtactatggaagat
ctggaacagctgacagcaaaagctagaaaactaggagttaaagtcgtactagactttgta
ccaaatcacacttcgaatgagcatccctggtttatcaaaagttatcaaggcattggaaaa
tacaaggattactatacctggcgcagaggacgtgataacaataaacaaccgccgaacaac
tggataagccttttcagcggtccagcttggacttacaatgcgaccagggacttatggtac
ttccatcaatttgaataccggcaacctgagcttaactatagcaatccaaacgttcgtcaa
gaaatggaggacgttttgcgattttggctaagtaaaggtgttgacgggttccgcgtcgat
gcggtcccccatctttttgaaaaagaaggacttcctgatgaacctttgtcgcacaaaccg
ggcgtttcaaaccaaagcgacagttacctcgaacatatttatgttaaagacgatccacga
agttatgatcttataaagacttggagaaaattagtcgacgactggtcggatttgcacaat
gaagacgaaaaggttataatgactgaggcatacactaatttagataacaccactaaatgg
tatcagtatggctctgacatacccttcaatttcaatttgataaccgaagttgacaacacg
tcgaaaccgattgattttaaaaaagtaatcgacgattggatggttcgcacaccatcgact
gggtccgctaactgggtgatgggtaatcacgaccgcagcagaatcggaaccaggtatccc
ggcagagccgatcaaatgacgatgctggccatgatcctccctggagtagcggtcacgtac
tacggcgaggaaatcggtatggtggacaaattggacatcacctgggaagctacgcaggat
ccgcaagcttgcaataccgatccagaacgctatcgcgcagtaacgcgtgatccaaacaga
acacctttccagtgggatgatactaaaaatgctggtttcagcaacgcttctacaacatgg
ctaccggtcaacgataattataaagaattgaatttggcgaaacaaaagcttcaacaagaa
tctcattacaaactttatcaaactttgacgaaattaagaagcacatctcttgctttgaaa
aatggtacattggacactgtcgtattgaacaataattcagtgctggccgtcataagaaaa
attgcagatgaagctgttgtactcttaattaatttctccaatgacagtccgcaaagtgtt
gatgtttcggagtatttaccaaacgccaaagatgctacagtcaaaggagcaagcgtagga
tctggcatcgagtggggatcaataataaagacttcggatgttcgattgcctccaaaagca
tcgatagttttagtacgttga

DBGET integrated database retrieval system