KEGG   Nasonia vitripennis (jewel wasp): 100121084Help
Entry
100121084         CDS       T01081                                 

Gene name
Ehmt1, G9a
Definition
(RefSeq) histone-lysine N-methyltransferase EHMT2
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100121084 (Ehmt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nvi03036]
    100121084 (Ehmt1)
Enzymes [BR:nvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100121084 (Ehmt1)
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100121084 (Ehmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 100121084
NCBI-ProteinID: XP_001604667
NASONIABASE: NV11612
LinkDB All DBs
Position
2
AA seq 1395 aa AA seqDB search
MSESDCMDTSSAVGSQKEDTEDEDMSSKSKLSIQQILEGMTNEFNNTPRKIQRSVVQVRK
PEKPQPKVVEDSAKVIKVNKSLNNVQEEVKIVKENVPQKKVEKSPAKSEEPQKQEATNKS
RIVLTFRTIDENTGQGKKTKISSCPSNLSLVPDELINCNQIGGVSVKIENFDEICDSVNK
SDKEDSQKQSPGKNVKSPTASKEKKNEQNNLEKNVLEKEKPSPETEKSNSETVVENRKNG
GDSVADKPPMESETITPVTRKARQKRLRELSVEPELKRSARRLSKESSKTTVLESAMARK
EKFNYTEESTKRKYSKPGRPRKVLPEKKDTIPLLNPIEPQKVVAEKDSIPKKDTALKKDT
LSKKESVAQKNNLSKKDNVPKKVEVSEVDVPPEKDIASKVDTSSPMKDDVSKSDISPRKD
NLPKKNHIPKLTPLDSIKPISEKKAPIPKLNPLVPQKLISDKHLPKLPKLSPLNSPRFMI
GKNKNNPKLDSSQKSNKYEGMPKLTPIIKNPEIVQQTFSQPSARTIKIVQDETLLENENE
AFRKPVSMKLKRIKNRIQAISNARKLAKGITGESLPSTEEDMGSSDDAMLEENSTSTKRM
RRHLIPSPSTAEGQASTPESTAILSKIRTGKPTKHEMQCLCEMRSQLFVTITSTESPLYC
TAMDSIDNQIVGCCNEVDHDDVAMRRPSARIPYIILCRKHKERLIRHNCCPTCGLFCSQG
KFVHCSNGHQYHRDCEMYYEKKPLCPHCGSYGLSFDVIITMAGKRKPVQPPLRKEFPKEP
SAKISLPGSGDNTKLAEQQPVQKKSDEPLINPELVHIPEPTNNANVEKPERYTFISLYNA
AKNGELQKLVNVLANGFNANHTFKEQGHRTGLHVAADKGFLACVHVLVQAGAQVDVLDRN
QLSPLMLAAANGKADVVRYLMKVGADVTLKGEDGMTALHMAAKSGHLDVCQVILSECKVP
RTLVDSVDDGGWTSLIWACEFRHADVARYLLNNKCDPLIRDSEQNIALHWSAFSGSSDIT
ELLLNLGCDVNAVNVHGDTPLHIASRQDQYAVSVLLLSRGAKVGEVNAMGETAIDCCGGT
GDTLNALQLNFKVNQRAEHMLEKTIKILTNDISRGKESNPVQCVNGFDSEDKPTDFVYVT
ESCFTSKVNVDRTITSLQSCRCEDNCSSDKCLCGNISLRCWYDDEGKLVPEFNYADPPML
FECNPACDCNKITCNNRVVQHGLTQRFQLFRTEGKGWGIRTLRHISKGSYVCEYVGEIIS
DSEADQREDDSYLFDLDNRDGETYCIDARRYGNLARFINHSCAPNLLPVRVFIEHQDLHF
PRIAFFANRDIDADEELGFDYGEKFWIIKCKSFTCTCGAEICKYSDKTIQTTLDNYRKKV
QAEEIRVAQQAAAKV
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatctgactgcatggataccagctcagctgtgggatctcaaaaagaagatact
gaagatgaagacatgtccagcaaaagcaagctgagcattcagcagatccttgaaggcatg
acaaatgaattcaacaacactccaaggaaaattcagaggtctgtagtacaagtgcgcaag
ccagaaaagccccaacccaaagttgttgaggacagtgcaaaggtcataaaagtgaataaa
agtttaaacaacgttcaagaggaggtaaaaattgtcaaagaaaatgtaccgcagaagaag
gttgagaagtcacctgctaaaagtgaagaaccgcaaaaacaagaagctaccaataaatca
agaattgttttgacattcaggactatcgatgaaaatactggtcagggcaaaaaaactaag
atctcaagctgcccatccaatttgtccttggtaccagatgaactgattaattgtaatcaa
attggtggagtgtctgtcaaaatagaaaattttgacgaaatttgtgatagtgtaaataaa
tcagataaagaagacagccagaagcagagtcctgggaaaaatgtcaaatctccaaccgca
agtaaagaaaagaagaacgagcaaaataatttggagaagaacgttttagagaaggaaaag
ccatcgccagaaactgagaaatcgaattctgaaacagttgttgaaaaccgaaaaaatgga
ggggattcagtcgctgataaacctccaatggaatcggaaacaatcacacccgttaccagg
aaagccagacaaaagcgactgagagaattaagtgttgaaccagagttaaaacgttctgct
agacgtttatcgaaagaatcatcaaaaactacagtactagaaagtgcaatggcaaggaaa
gaaaaattcaattacacagaagaaagcaccaagagaaaatacagtaagcctggaaggccc
agaaaagttcttcctgaaaagaaggatactatacctttacttaatcccatagagccacaa
aaggtagttgcagaaaaagatagcatacctaaaaaagatactgcattaaaaaaagatact
ttatccaaaaaagagagtgtggctcagaaaaataatttatccaaaaaggataacgtacca
aaaaaagttgaagtctccgaagtagatgttccaccagaaaaagatatagcttccaaagta
gatacttcctctccaatgaaagatgacgtttccaaatcagatatttctccaagaaaagat
aaccttccaaagaaaaaccatatacctaaattgactcctttggattctatcaaaccaatt
tcagagaagaaagctcccatacctaagctaaatcccttagttcctcaaaaattgatttca
gacaaacacttaccaaaattaccgaaattaagccctttgaattctccgaggtttatgatt
ggaaaaaataaaaataatcccaagctagattcttcacaaaaatcgaataagtacgagggt
atgccaaaattgacgcctatcataaaaaaccccgaaattgttcaacaaacgtttagtcaa
ccatcagccagaacaattaaaattgtgcaggatgaaacgcttttagaaaacgaaaacgaa
gcatttcgaaaaccagtctcaatgaagcttaaacgcattaaaaatagaattcaagcaatc
agtaatgctagaaaactagccaaaggtattactggagagagtttgccttccactgaagaa
gatatgggctcttccgatgacgcgatgcttgaagaaaattcaacgtcaacaaagcgtatg
cgccgacatttgattcccagtcctagcacggctgagggacaggcatccacgcctgaatct
acagccattctaagcaagattcgcactggaaaaccaactaagcatgagatgcagtgctta
tgcgagatgcggtcgcagttattcgtgacaatcacaagcaccgaatcgccgttgtactgt
acagccatggactccatcgataatcaaatcgtaggctgctgtaacgaagtcgatcacgac
gatgtggccatgcgtaggcccagcgcccggataccctacatcattctctgtcgcaagcac
aaggagagattgataagacacaactgttgcccgacatgtggactgttttgctcccagggc
aaattcgtgcactgttcgaacggacatcagtatcaccgcgactgcgagatgtattacgaa
aagaaacccctgtgtccgcactgcggtagttatggtctatctttcgacgttatcattacc
atggcgggaaaacgcaaacccgttcagcctccactgcgtaaagagtttccaaaggaacct
tctgctaaaataagtttgcccggatcaggcgataatacgaagcttgccgagcagcaacct
gtacagaagaaatcggatgaacctcttatcaaccctgaactcgttcacattcccgaaccg
actaataatgcgaacgttgagaaacccgagcggtatacattcataagtttatacaatgct
gctaaaaacggagaattgcagaaattagttaatgttttagcaaatggtttcaatgccaat
cacacgtttaaggagcagggccatcggaccggcctccacgtagccgccgataaaggcttc
ttagcttgcgtacacgttctggttcaagccggtgcccaagtagatgttttagatagaaat
caattgtctcccttgatgttggctgccgctaacggcaaagctgacgttgttcggtatttg
atgaaagtaggcgctgacgtaacgttgaagggtgaagatggtatgactgcactgcacatg
gctgcaaagtctggccacctggacgtatgtcaagttatcttaagcgagtgtaaagtacct
aggactttagtagattcagtagatgacggtggttggaccagtttaatttgggcttgcgaa
ttccgtcacgcggacgtggcacgatatttattgaataataagtgtgatccattgattaga
gattcagaacaaaatattgcgcttcattggagcgccttcagcggtagttctgatataacg
gagctacttcttaacttaggctgtgatgtgaatgcggttaatgttcatggcgacactcca
ctacacatagcatcacgacaagatcaatatgccgtgagcgttttactgctgtcaagaggt
gccaaagtcggagaagtgaacgctatgggtgaaacagccatagattgttgcggtgggact
ggagatactttgaatgcactccagttgaatttcaaagttaatcagcgagccgaacatatg
ttggaaaagaccatcaaaatattaacaaacgatatttctcgaggaaaagagtcaaatcct
gtccaatgtgtgaatggcttcgactcagaagataagcccaccgattttgtttatgtaacg
gaaagctgttttacaagtaaagtaaatgttgatcgtaccatcacgtctttgcaatcctgt
cgttgcgaagacaattgtagctccgacaaatgtctatgcggtaatattagtttacgctgc
tggtatgatgatgaaggaaaacttgtacctgaatttaattatgctgatccacccatgctg
ttcgagtgtaatccagcttgtgattgtaacaagataacgtgtaataatcgtgttgtacag
catggtttgactcaacgatttcagttgtttagaacagaaggaaaaggttggggcataaga
acccttcgtcacatctcgaaaggaagttacgtttgcgaatatgtaggtgaaataatttct
gattctgaagcagaccaacgagaagacgactcatatctatttgatttagataatagggat
ggagaaacgtattgcatcgatgcaagacgctatggaaatttagcccgctttatcaatcat
tcttgcgctccaaatttgttaccagtgcgagttttcattgaacaccaggatctacacttt
ccacgaatagcgttttttgctaatagagatatagatgcagatgaagagttaggctttgac
tatggcgagaaattttggataataaagtgcaaatcttttacgtgcacctgtggtgcagaa
atctgcaaatattctgataaaacaatacagacgacactcgataattatcgcaaaaaagtg
caagcagaagaaattcgagttgcacaacaggcagccgcgaaggtgtaa

DBGET integrated database retrieval system