KEGG   Nasonia vitripennis (jewel wasp): 100122644
Entry
100122644         CDS       T01081                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X2
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00230  Purine metabolism
nvi01100  Metabolic pathways
nvi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100122644
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100122644
Enzymes [BR:nvi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100122644
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 100122644
NCBI-ProteinID: XP_008210097
NASONIABASE: NV16530
UniProt: K7J585
LinkDB
Position
4
AA seq 993 aa
MSMSRGETSNEESYLNSGRPSNLLKTSFSSSKLERLYRSSSLQQRRGGLQCFLISAVLYD
FYSFGLTDAELPARGLTAVFLGLNLGLLAWAERGTRARDALWSVVPHVAWQISIAQLLAP
LFLKSAEVTPRDSLGWLLLLLYLHFATLPLRFSLCALLAVGTAATYMVSVYGLSKAPVPL
EVLILTVTLSLCAAALGASSYSLAEFQQRRAFLETKQSLEVQLIIEEQSAEQERLLLSVL
PEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASDLVKILNEL
FARFDQLSERYEQLRIKILGDCYYCISGAPKERPDHAVLCIHMGLSMVEAIKYVQQTTNS
PVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNVTLSFLSGE
FEVEPAYGEQREEALQKAGITTYFIVKALKPFKPALTKSLASLADAEFSQRAISSADAQT
KEDSEDFRQRLRKELDSRGGGAELKGHASWITLAFKDAQLEKGFHSAEEAFSPLSLLGGP
LVMVCASPVWRLQPWGPFTWGGAGVVTLFGIVLAGATCLGSAVRARWLRRTLALLMIFSM
SVFLLLDMANCGIIDLEPATNVSMSWSPRCPYPSYYSYIGVLALVVISMPAYICYLGKAF
LMFMLAGAQCTINVLFLGPTLDHEHMATTSPGQKVLPLKYSLSATLLTIAIALVVVARYT
EKARRVLYLRGREVEAQRERAADMKRRNGALIYNILPPHVAAYFLSNTRHHDDLYSQSYA
EVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQDKYKDIIKIKTIGST
YMAASGITESEERANEPQWQHLSRLVEFSLDMKNALSIINEQSFNHFVLKMGINHGPVTA
GVIGARKPHYDIWGNTVNVASRMESTGKVGCLQVTDETRKILEPFGYGFEQRGMVFVKGK
GQLLTHYLIKKDGVPLNLDSDLPIEPAHPIIYQ
NT seq 2982 nt   +upstreamnt  +downstreamnt
atgtcgatgtctcgcggcgagacgtcgaacgaggagtcctacctgaacagcggccggccg
tcgaacctcctgaagacgagcttttcgagtagcaagctcgagcgtctctatcgctcgtcg
tcgcttcagcagcgccgaggtggcctccagtgtttcctcatctcggctgtgctttacgac
ttctacagtttcgggcttacggacgcggaactgcccgcgcgcggcctcacggccgtcttc
ctcggactgaatctcggtttgctggcctgggcggaaagggggacaagggcgagggacgcg
ttatggtcagtggtaccgcacgtggcctggcagatttccatagcgcagctactcgccccg
ctgttcctcaagtccgccgaggtcacaccccgagacagtcttggctggctgctgctcctg
ctctatctgcattttgccactctgccgctgaggttctccctatgcgcgcttctggcagtt
ggaaccgcggcgacttacatggtatccgtttacggactgtccaaggctccggtaccgctt
gaggttctgatcttgacggtgacgctgtcactatgcgccgcggccttaggcgcctcgagc
tactcgctggccgagttccagcagcgtcgagctttcctcgagacgaagcagagcctcgag
gtgcagctgataatcgaggaacagtcggccgagcaggagcgactattgctcagtgtctta
cctgaacacgtggccgtgaagatgcgacaggatttgggagcttcgctcgacacgcagttt
aagaagatctacatgtcgaggcacgagaacgtctcgatactctacgccgacatcgtcggc
ttcacggccatatcgtcgacctactcagccagcgatctcgtcaagatactcaacgagctt
ttcgccaggttcgaccagctcagcgagaggtacgagcagctgcgcataaagatcctgggc
gactgttactactgcataagcggagcaccaaaggaacgtccggatcacgcggtcctctgt
atccacatgggcctgtctatggtcgaggctatcaagtacgtccagcagacgactaatagt
ccggtcgacatgcgcgtcggcatacacacaggcgccgtccttgcaggtgtactgggacag
cgacagtggcagttcgacgtctacagcaaggacgttgagctggctaataagatggagagt
agcgggagagccgggcgagttcacatctcgaacgtgacgctgagcttcttgagcggcgag
ttcgaggtcgaacccgcgtacggcgagcagagggaggaggcgctgcagaaggctgggatc
accacgtacttcatagtgaaggcgctgaaaccgttcaagcctgcgctgaccaagagcttg
gcgtcgctggccgatgctgagttctcgcagagggccataagcagtgccgatgcccagacc
aaggaggattccgaggactttaggcaacgacttcgcaaggaactcgatagtcgaggcggc
ggagcagagctgaagggtcacgcgtcctggatcacgctggccttcaaggacgcccagctg
gagaagggcttccacagcgcggaagaggcgttctccccgttgtccctcttgggaggtcct
ctggtgatggtatgcgcgtctccggtctggcgactacaaccctggggtccgttcacctgg
ggcggcgccggtgtcgtcacgctcttcggtatcgtactcgcaggggccacgtgtcttggc
agcgctgttcgcgcccgatggctcaggcgcacgctcgcccttctcatgatattctccatg
agcgtctttcttctcctggatatggccaactgcggtataatcgacctggagccagcaacg
aacgtctcgatgagttggtcaccccgctgtccttacccctcgtactactcgtacatcggc
gtactggccctcgtggtaatctcgatgccagcctacatctgctacctcggcaaagccttc
ctcatgtttatgctggctggagctcagtgcacaatcaacgtcctcttcctcgggccgact
ctcgaccacgagcacatggccaccacgtcgccaggacaaaaggtccttcctctcaagtac
tcgctctcggctacgcttctgaccatcgccatagccctcgtcgtcgtcgcccgatacaca
gagaaggcgaggcgagtgctgtacctgcggggtcgcgaggtcgaagcccagagggaacga
gcagccgacatgaagcggcgcaacggcgccctgatctacaacatcctgccgccccacgtg
gcggcctacttcctctcgaacacccggcaccacgacgacctctacagccagagctacgcc
gaggtcggcgtcttgttcgccagtatgcccaactttgctgatttctacagcgaggagagc
atcaacaaccagggactcgagtgcctcaggttcctcaacgaggtcatctccgatttcgat
gcgatcctcgatcaggacaagtacaaagacatcataaagatcaagacgataggctcgacg
tacatggcggcctctggtataaccgagtcagaggagagggctaacgagcctcagtggcag
catctctcgaggctcgtcgagttctccctcgacatgaagaacgccctgtccatcatcaac
gagcagagcttcaaccacttcgttctaaaaatgggcatcaatcacgggcccgtcactgct
ggggtcatcggggccaggaagcctcactacgacatctggggtaacacggtcaatgtggcc
tcgaggatggagagcaccggcaaagttggatgcttgcaggtaacggacgagacgcgaaag
atcctggagcccttcggctacggtttcgagcagcggggcatggtcttcgtcaagggcaaa
ggtcaactactaacccactacctgatcaagaaagacggcgtcccgctgaacctcgacagc
gatttaccgatcgaaccggcacatccgatcatctatcagtaa

DBGET integrated database retrieval system