KEGG   Nasonia vitripennis (jewel wasp): 100122984Help
Entry
100122984         CDS       T01081                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03030  DNA replication
nvi03410  Base excision repair
nvi03420  Nucleotide excision repair
nvi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100122984
   03410 Base excision repair
    100122984
   03420 Nucleotide excision repair
    100122984
   03430 Mismatch repair
    100122984
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nvi03032]
    100122984
   03400 DNA repair and recombination proteins [BR:nvi03400]
    100122984
Enzymes [BR:nvi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100122984
    6.5.1.6  DNA ligase (ATP or NAD+)
     100122984
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100122984
DNA replication proteins [BR:nvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100122984
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100122984
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100122984
   NER (nucleotide excision repair)
    Other NER factors
     100122984
   MMR (mismatch exicision repair)
    Other MMR factors
     100122984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 100122984
NCBI-ProteinID: XP_001606591
NASONIABASE: NV14507
UniProt: K7IZI0
LinkDB All DBs
Position
3
AA seq 1128 aa AA seqDB search
MSQRSITSFFSKVNPKSDKDEVESVKKSDSKVENTDISNGKRKRDKSSEVKKSPSSRKSA
AKGTDKKVEPAVKRRKSTANSKQSLAQKKTKASTQKKSKKKQEESNSESESDSPPTKEVE
EFSSEEDDGPTERNTRGKNKKAESEAVRRLRNIVDSDTSSDEEKQAANGKGKSSKESTQS
SASKKNKSIVDDDTEQEEDEESNGKAMKEDEEETTEVDSSSEEKASKDEASSDEKDSDDD
DRVKEKKKNSKESKESTMSKLKNFAYNEDTPKKKSTKNKEKDESENESKNLKALESDKKS
KDEEKSENDEDENEKSNITEESKETPKVSTSNKEAKKSPIPKKSTTSKKSHSTKKSPSIR
KTPASKKTPVSKRSAKVAGKKEESDEDDEVVTKKPKKTSNTLSESPPQKKQENGSKNGSE
SPEKQSGKDSDVKEEKDKTSAKEEKKDSPSSKKPSSNGLASIFGGKAKQTNESLDYNPAK
SSYHPINDAFWKEGQKVPYLALTRTFELIEDISARLKIIEILSNYFRSVIVLSPDDLLAS
IYLCLNQLAPAYEGLELGIAETNLMKAIASSTGRTLAQIKSELQKVGDLGVIAEGSRSNQ
KMMFQPPPLTVNTVYAKLKEIASTTGTSSGMKKVDKIQSLFVACRHSEARYLIRSLAGKL
RIGLAEQSVLQAIALACAMTPPEQSRPFEVLNASKGISSESFKQNYDEVALILKTTYCQC
PNYNKIIPVILKKGIKELPNECKLTPGIPLKPMLAHPTKGIQEVLSRFEGLKFTCEYKYD
GERAQIHIQEDGAVKIYSRNQEDNTSKYPDIINRISNTRHESVKSCVLDCEAVAWDKEKK
QILPFQVLSTRKRKDANEADIKVQVCVFMFDLLYFNGSALVEEPLKKRRELLKEYFKEVE
GEWCFAKSVDVQTMDEVQEFLDESIKGNCEGLMIKTLEKEATYEIAKRSRNWLKLKKDYL
EGVGDTLDLVVIGGYIGKGKRTGTYGGFLLACYDQENEEYQSICKIGTGFSEDDLTKHTE
ALKECVIDQAKSYYRCDSSLEPDHWFEPKLVWEVKCADLSLSPVHGAAKGIVDPEKGISL
RFPRFIRVRDDKNSEDATSAQQIADMYLSQEQIKNQTSSAGPAEEDFY
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcgtagcattacatcgtttttcagcaaagtaaatccaaaatctgataaagat
gaagtagaaagcgttaaaaaaagtgattctaaagtggaaaatactgacatcagcaatgga
aagcgtaaaagggacaagagcagtgaagttaaaaagtcaccgtcgtcacgaaagtcggct
gccaaagggaccgataaaaaggtggaaccagctgtaaaacgtcgaaaatctactgctaat
agtaaacaatctcttgctcagaaaaaaacaaaggcaagtactcagaaaaaaagtaaaaag
aaacaggaagaaagcaattccgaaagtgagtcagattctccaccaaccaaggaggttgag
gagttttcatcagaagaagatgatggtcccactgaaaggaacaccagaggtaaaaacaag
aaagcagaatctgaagctgtgaggaggctcaggaatatcgttgattcggatacttcatcg
gatgaggaaaagcaagctgcgaatgggaaaggtaagagtagcaaggagtccacacaatca
agtgcatcaaagaaaaataaaagtattgtcgacgatgatactgagcaagaggaggatgaa
gaaagtaatggaaaagcgatgaaggaagatgaggaagaaactacggaagtcgattcttct
tcagaggaaaaggccagtaaagatgaggcttcctcagatgaaaaagacagtgacgacgat
gatcgagtgaaggagaagaagaagaatagcaaggagtcaaaagaatctacgatgtccaag
ttgaagaactttgcttataatgaagatacacctaaaaagaagtcaacaaagaataaagag
aaagatgaaagtgaaaatgaatctaagaatttaaaagcattggaaagtgacaaaaaatct
aaagatgaagagaaatcagaaaatgatgaagatgaaaatgaaaaatcaaatataacagag
gaatccaaagaaacccctaaagtatcaacaagcaataaagaagccaaaaaatctcctata
cctaaaaaatctactacatctaagaagtctcattctaccaaaaaatctccttccataagg
aaaactccagcctcaaagaagacccctgtgtccaagagatcagcaaaagttgctggaaaa
aaagaagaatcggatgaagatgatgaagtagttaccaagaaacctaaaaagacaagtaat
acattatcagaatcaccgcctcaaaagaagcaagaaaatggatccaagaatggcagcgaa
tctccagaaaaacaaagcggcaaagacagtgatgtgaaagaagaaaaagataagacaagt
gcaaaagaagaaaaaaaagattctccatcatcaaagaaacctagttctaatgggttagct
agtatatttggtggaaaagccaaacaaactaatgaaagtcttgactacaatcctgctaaa
tcatcttatcatccaatcaatgatgctttttggaaagaaggccaaaaagttccatatttg
gctctaacaagaacttttgaattgatagaagatataagtgccagattgaaaattattgaa
atattgtcaaattattttcgttctgtaattgttttgagcccagatgatcttcttgctagc
atctacttgtgtttgaatcaacttgctcctgcttatgaaggacttgaactaggtattgct
gaaacaaacttaatgaaagctatagctagctcaactggtagaacacttgctcagataaaa
agtgaactacaaaaagttggtgatttaggtgtaattgcagaaggtagtcgatcaaatcag
aaaatgatgttccagcccccaccactcactgtaaatactgtctatgctaaattaaaagaa
atagcttccactacaggaacatcatcagggatgaaaaaagttgacaaaatacagtcatta
tttgtagcttgtcgtcactcggaagctcggtatttaatcaggtccttagctggaaaacta
agaataggactagcagagcaatctgtcttgcaagccatagctctggcttgtgcaatgact
cctccagaacagagtcgtccattcgaagtgttgaatgcttctaaaggcatatccagtgaa
tctttcaagcaaaactacgacgaggtggctttaattcttaaaactacttactgtcagtgt
ccaaattacaacaaaatcattccagtaattttgaaaaaaggcatcaaagaattgcctaat
gagtgcaaactcacgccaggaatccctctcaagcctatgcttgctcatccaacaaagggt
attcaggaagtactctcgcgattcgaaggtttgaagttcacttgcgaatacaagtacgac
ggagaacgagctcaaattcacattcaagaagacggagcggtcaaaatatacagcagaaat
caggaagataataccagcaagtatccagatatcataaatcgtatttcaaacacgcgacac
gaatctgtcaagagttgtgtgttggattgtgaagcggtcgcctgggataaagaaaagaag
cagattctgccattccaggttctcagtaccagaaaacgtaaagatgcgaacgaggcggac
atcaaggtgcaagtatgtgtatttatgttcgatcttctttacttcaacggatcagctttg
gtagaagaaccgctgaagaaacgccgagaattgctgaaagaatactttaaagaggtagag
ggcgagtggtgtttcgcaaagagcgtagacgttcagaccatggacgaagtgcaagaattc
ctcgacgaatctataaagggcaattgcgagggtttgatgataaagactttggaaaaggag
gcgacttacgagatagccaagaggtcacgaaattggctgaagctcaagaaagactatttg
gaaggagtaggagacactttggatctcgtggtaatcggtggttacatcggaaaaggaaag
cgaactggtacttacggtggttttcttctggcctgctacgaccaagaaaacgaagaatac
cagagtatctgcaaaattggtacaggtttcagcgaggacgatctgacaaagcataccgaa
gctctcaaggaatgcgtcattgatcaagcaaaatcctactaccgatgcgattccagtctc
gagccggatcactggttcgaaccaaaattggtatgggaagtcaaatgtgcagatttatct
ttatcccccgtacacggagccgctaaaggtatagtcgatccagagaaaggtatatcgctg
agatttccaaggtttattcgagtgagggacgacaaaaattctgaagacgcgacgtctgct
caacagattgccgacatgtatttgagccaagagcaaatcaagaatcaaacgtcatctgct
ggaccagcagaggaagacttttattaa

DBGET integrated database retrieval system