KEGG   Nasonia vitripennis (jewel wasp): 100123442
Entry
100123442         CDS       T01081                                 

Definition
(RefSeq) probable serine/threonine-protein kinase DDB_G0276461
  KO
K18496  fibroblast growth factor 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nvi04052]
    100123442
   00536 Glycosaminoglycan binding proteins [BR:nvi00536]
    100123442
Cytokines and growth factors [BR:nvi04052]
 Growth factors
  Growth factors (RTK binding)
   100123442
Glycosaminoglycan binding proteins [BR:nvi00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100123442
SSDB
Motif
Pfam: FGF SH3_9
Other DBs
NCBI-GeneID: 100123442
NCBI-ProteinID: XP_001607087
NASONIABASE: NV12049
UniProt: K7ISK1
LinkDB
Position
3
AA seq 253 aa
MSLRWIHENLEPPNCDEECSDIDDSCSDDSYDSDLDLPDGISCNNSNNNYDSRNHNDNQR
NNNNVNGQNGLVRSKRETRRHPTTTVSIDENGKPHFESEEPEKTQKPHLTWDQASNNPMY
CQSLKLKLFCRTGYFIGITPSGRARGFPADSTNDAHVRLIVCPVSSGIVRLQSAETGHYL
AFNATGHLYGEKRANKDNTEWEQWSIGTYDAFRSHKYAEPGWWLGIKRNGRHKPGPKTAW
GQKAVQFLAVRLA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagcctacgctggatccacgagaacctggagcctccgaactgcgacgaggagtgtagc
gacatcgacgacagttgcagcgacgacagctacgattcggatttggatttgcccgacgga
attagctgcaataattccaacaacaattacgacagtcggaatcacaacgataatcagcgg
aacaacaataatgtgaatggtcagaacgggctggtcaggagcaagagggagacgcgcaga
cacccgacgactacagttagcatcgatgaaaatggtaagccacactttgaatcagaggag
ccggagaagacgcaaaaaccgcacttgacatgggatcaggcatcgaataatccgatgtac
tgtcaatcgctgaaattgaagctcttctgtaggacgggctacttcatcgggatcacacca
tcgggtcgagcgagaggttttcccgctgatagcactaacgacgcccacgtgcgtctgatc
gtctgtccggtatcttccggaatagtccgattgcagagcgccgaaactgggcattactta
gccttcaatgccacgggacacttgtacggcgagaaacgagcgaacaaggacaataccgag
tgggagcagtggagcatcggtacctacgacgcttttcgctcccacaagtacgctgagccc
ggctggtggctcggcatcaagagaaatggtcgacacaagcctgggccaaagacagcttgg
ggtcagaaggcagtacagtttttagccgttcgactcgcgtga

DBGET integrated database retrieval system