KEGG   Nasonia vitripennis (jewel wasp): 100124137Help
Entry
100124137         CDS       T01081                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00052  Galactose metabolism
nvi00500  Starch and sucrose metabolism
nvi01100  Metabolic pathways
nvi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100124137
   00500 Starch and sucrose metabolism
    100124137
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100124137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100124137
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100124137
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100124137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF948 DUF5110
Motif
Other DBs
NCBI-GeneID: 100124137
NCBI-ProteinID: XP_016841489
NASONIABASE: NV10990
LinkDB All DBs
Position
5
AA seq 1088 aa AA seqDB search
MSKKSSEFVAVFTRRNHQGNPEESQETLLTESGDSQSMVSWTDTSIKAYFKQILPYVSPI
FLIIKWIGYLVMFILTTYVLLQCTQYFKEAKIQQEHIYEELNSFHVNAEEKLKELNDLQE
TMEDKLENINILTEQGSKRIKDMFTFSKTDLLKDYEEDNGEQCDFIPLNLRFDCHPENGA
SELSCRNRGCCWNVLHQLHYEKLVPLDVPYCYYPKNWSLYKYQNFSKDGNDFSGLLRLER
DSFYKKDLKLVKIEATGIDDTTLRVKIFDPMNKRYEPPFPARSDPRPFMKKTSNPLYELK
MDENVPGFKVMRSSDKRTLFNSIGFGGFIFSDQFLQISSVLPSHNIYGLGEHRTNLRLNT
NWQKLTLFNSDQPPTENANLYGSHPFYMVVEKTGKAHGVLFLNSNAMDIILQPTPAITFR
SIGGIFDIYFFTGPTPADVLKQYSEIVGKPFLPPYWSLGFHLCKYGYGTLEKTKAVWQRT
RDALIPFDTQWNDLDYMDNNNDFTYDKTKFKDLPNFIQEIHDAGMHYIPLIDAGVSANEK
NGTYIPYDEGVKRGIFIFDGESNEPFKGKVWNTVSTTWPDFTNPETTSYYTEMMSNMHKD
FEYDGAWIDMNEPSNFYNGHINGCKATSLDNPPYLPNVNGNLLARKTVCMNAKQHLGNHY
DLHNVYGTSQAVVVNHALKQIRNKRPFIISRSTWEGHGFYAGHWTGDVYSAWHDLRMSIP
EILAYSLFQIPMVGADICGFDGNTTVALCNRWMQLGAFYPFSRNHNSDDTIDQDPVAMGQ
LVVESSKKALRIRYRLLPYLYTLFYRAHRYGETVARPLFIEFNEDPMTFNIDTQFLWGSC
LMIAPVLEEGKTEVHVYIPRGLWYNYHTMEFSFTIGKNYTLDAPMDTIPLLVRGGCIIPV
QEPSVTTSLSRQKPFGLLIALDEHESAKGELYWDDGDSLDSIEKKKYNLFEFEVSNNVLT
STVIECSFDDKMKLGTIIVMGISKVVKQVLFNDKDVEFEYDKEKSVLYVNNILVDFTKKF
ELRWSYKKIEDPSTTTALPIQKYSTSHPADVDASHNEGQYMNSAPTYSSSITYASLLNLI
VIKYFMLV
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaagcagtgaatttgttgctgtctttacaagacgcaaccatcaaggaaac
cctgaagaatctcaagaaacactattgactgaatcaggagacagccaaagcatggtatcg
tggacggataccagcataaaggcatattttaagcagattttaccatatgtatcgccaata
tttttgataatcaaatggattggataccttgtgatgtttattcttactacttacgtactt
ttgcaatgtacacaatatttcaaagaagccaaaatacaacaagaacatatctacgaagaa
ttgaatagttttcatgtaaacgcagaagaaaaattgaaagagttaaatgatcttcaagaa
actatggaggacaaacttgaaaatataaatatacttaccgagcagggctcgaagagaatc
aaagacatgtttacattttctaagactgatttgttgaaagattatgaagaagataatgga
gagcagtgtgattttattccattgaatttaagatttgattgtcatccagaaaatggagcc
tctgaactatcatgcagaaatagaggttgttgctggaatgtactacatcaattacactat
gaaaaactagttcctcttgatgtgccttattgctattatccaaaaaattggagtttgtac
aagtatcaaaacttcagtaaagatggtaatgatttttctggactgttgcgtttagaaaga
gattcattctacaaaaaagacttgaaacttgtgaagattgaagctactggtatagatgat
actactttaagagtaaagatttttgatcctatgaataaaaggtatgaaccgcctttccca
gcaagatcagatcctaggccattcatgaagaagacttctaatccactttatgaactcaag
atggatgaaaatgttcctggtttcaaagtaatgcgatcaagtgataaaagaactctattc
aattctataggatttggtggcttcatcttttctgatcagttccttcaaataagctctgta
ttaccttctcataatatttatggacttggagagcacaggactaatttaagattgaacact
aattggcaaaaactcactctttttaattccgatcaacctcctaccgaaaatgccaacctt
tatggatctcatccattttacatggtagttgagaagacaggaaaggcacatggtgttcta
tttttaaatagtaacgcgatggacattattttgcaaccaacccctgcaattacattcaga
agtattggaggcatttttgatatctacttttttacgggcccaacaccagctgatgtattg
aagcagtactctgaaatagttggaaagcctttcttaccaccatactggtcactaggtttt
catctttgtaaatatggttatggaactttagaaaagactaaagccgtttggcagagaaca
agagatgccttaattccctttgatactcaatggaacgatttggactatatggataataac
aacgatttcacctatgataaaactaaattcaaagatcttccaaatttcattcaagaaatc
catgatgctggaatgcattacattccattaattgatgctggcgtgtcagcaaatgagaag
aatggcacgtacattccgtatgatgaaggcgtcaaacggggcatattcatattcgatgga
gaaagcaatgaaccatttaaaggaaaagtatggaatacagtatctactacttggcccgac
ttcacgaacccagaaacgacttcttattatacagaaatgatgagcaatatgcacaaagat
tttgaatatgatggtgcttggatagacatgaatgaaccgtctaacttctataatggccat
attaacggctgcaaggcaacttcccttgacaatcctccatatttacctaatgtcaatggt
aatctattagcaagaaaaaccgtttgcatgaacgccaaacagcatttgggtaatcattat
gatcttcacaacgtttatggtactagtcaagcagtggttgtaaatcatgcattgaaacaa
atccgcaacaaaagaccatttataatttcccgatctacgtgggaaggacacggtttttac
gcaggacattggactggagatgtatattccgcatggcatgacttgagaatgagcatacca
gagattttagcctatagcttgtttcaaattccgatggtcggcgcagatatttgtggcttt
gacggaaatactacggtagccctatgtaataggtggatgcaattaggagcattttatcca
ttctctcgaaaccacaattcagatgataccattgatcaagatccagtagcaatgggccaa
ttggttgtcgagtcttccaagaaagctttaagaatcagatatcgacttttaccatacttg
tataccttgttctatcgcgcacatcgttacggcgagaccgtggctcgacctttgtttatc
gagttcaatgaagatcccatgacgttcaacatagatacccaattcttatggggtagttgt
cttatgatagcgccagttctcgaggagggtaagactgaagtgcatgtttacattcccaga
ggcctttggtacaactatcacacgatggaattttcatttactatcggtaaaaattacaca
ttggatgctccgatggataccatcccattgctagttcgtggaggatgtattatacctgtt
caagagccaagtgttacaacaagccttagtcgacaaaaaccatttggtttgttaattgct
cttgacgaacatgaaagtgccaagggggaattgtactgggacgatggagatagtttagat
tcaatcgagaagaaaaaatataatctgtttgagttcgaagtttcaaacaacgtattaaca
agcactgtgatcgaatgttcctttgacgataaaatgaaactaggaacaatcattgtcatg
ggtatctctaaagttgtcaaacaggtcttattcaatgacaaggacgttgaatttgaatat
gataaggaaaaatctgttttgtacgtgaataacatattagttgactttacaaagaaattt
gaattgcgctggagctataagaaaatagaagacccttcgacaacaacggcattaccaatt
caaaaatattcaactagtcatcctgctgatgttgatgcaagccataacgagggacagtat
atgaattctgctccgacttattcaagtagtattacttatgcatctctcttgaacttaata
gtcatcaagtattttatgttagtatag

DBGET integrated database retrieval system