KEGG   Nasonia vitripennis (jewel wasp): 100679197Help
Entry
100679197         CDS       T01081                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 100679197
NCBI-ProteinID: XP_003428021
LinkDB All DBs
Position
3
AA seq 123 aa AA seqDB search
MLRARLAMADRNPDSQEARIKGKHCRRLNFGDDANDDSLPSKEEIERKFAEEMDKHQKEK
QAKWNFDFKQGRPLEGRWEWERLDSNNEVTNARNTGNSSRAAAPGNSDARSGRAQGDAAN
QAP
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagcccggctcgcgatggcagataggaatcccgacagtcaggaggcgaggatc
aagggcaagcactgcagacgtttaaacttcggcgacgacgcgaacgacgacagcctgccg
agcaaggaggagatcgagcgtaaattcgccgaggagatggacaagcaccagaaggagaaa
caagccaaatggaacttcgacttcaagcagggccgcccactggaaggccgctgggagtgg
gagcgactggacagcaacaacgaagtgaccaacgctcgcaacaccggcaactcgtcgaga
gcagcagcccctggaaactcggatgcgcgatctggtcgagcgcagggggatgcagcgaac
caggcgccctga

DBGET integrated database retrieval system