KEGG   Nasonia vitripennis (jewel wasp): 100679197
Entry
100679197         CDS       T01081                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100679197
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100679197
NCBI-ProteinID: XP_003428022
UniProt: K7JLR9
LinkDB
Position
3
AA seq 127 aa
MKDLTLSARLAMADRNPDSQEARIKGKHCRRLNFGDDANDDSLPSKEEIERKFAEEMDKH
QKEKQAKWNFDFKQGRPLEGRWEWERLDSNNEVTNARNTGNSSRAAAPGNSDARSGRAQG
DAANQAP
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaaagatttgacgttgtcagcccggctcgcgatggcagataggaatcccgacagtcag
gaggcgaggatcaagggcaagcactgcagacgtttaaacttcggcgacgacgcgaacgac
gacagcctgccgagcaaggaggagatcgagcgtaaattcgccgaggagatggacaagcac
cagaaggagaaacaagccaaatggaacttcgacttcaagcagggccgcccactggaaggc
cgctgggagtgggagcgactggacagcaacaacgaagtgaccaacgctcgcaacaccggc
aactcgtcgagagcagcagcccctggaaactcggatgcgcgatctggtcgagcgcagggg
gatgcagcgaaccaggcgccctga

DBGET integrated database retrieval system